Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTLZD0FO)
DOT Name | UL-16 binding protein 5 (RAET1G) | ||||
---|---|---|---|---|---|
Synonyms | Retinoic acid early transcript 1G protein | ||||
Gene Name | RAET1G | ||||
Related Disease | |||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLT LQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTM SFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPPTMSSGTAQPRATATTLILCCLLIMCLL ICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSDSYQIAKRPLSGGHVTRVTLP IIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS |
||||
Function |
[Isoform 1]: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity; [Isoform 3]: Down-regulates the expression of KLRK1 and stimulates natural killer cells to secrete IFNG; [Isoform 2]: Stimulates natural killer cells to secrete IFNG.
|
||||
Tissue Specificity |
Isoform 1 is highly expressed in colon and in a number of tumor cell lines and highly restricted in normal tissues. Both isoforms are frequently expressed in cell lines derived from epithelial cancers, and in primary breast cancers.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||
References