Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO1T7OA)

DOT Name	MHC class I antigen HLA-B18 (HLA-B18)
Gene Name	HLA-B18
UniProt ID	O77967_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00129
Sequence	SHSMRYFYTAMSRPGRGEPRFIAVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWD RNTQISKTNTQTYRESLRNLRGYYNQSEA

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Penicillamine	DM40EF6	Approved	MHC class I antigen HLA-B18 (HLA-B18) increases the Dermatomyositis ADR of Penicillamine.	[1]
------------------------------------------------------------------------------------

References

1	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.