Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOGLK0I)

• DOT Name: Uncharacterized protein C9orf152 (C9ORF152)
• Gene Name: C9ORF152
• UniProt ID: CI152_HUMAN
• Pfam ID: PF15733
• Sequence:
  MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLL
  VLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTH
  LEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPC
  QVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSA

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Uncharacterized protein C9orf152 (C9ORF152).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized protein C9orf152 (C9ORF152).	[5]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Uncharacterized protein C9orf152 (C9ORF152).	[2]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Uncharacterized protein C9orf152 (C9ORF152).	[3]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of Uncharacterized protein C9orf152 (C9ORF152).	[4]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Uncharacterized protein C9orf152 (C9ORF152).	[4]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Uncharacterized protein C9orf152 (C9ORF152).	[6]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Uncharacterized protein C9orf152 (C9ORF152).	[7]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Uncharacterized protein C9orf152 (C9ORF152).	[8]

References

• [1] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [2] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [3] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [4] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [7] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [8] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.