Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPBW3NC)

• DOT Name: POU domain class 2-associating factor 2 (POU2AF2)
• Synonyms: Oct coactivator from tuft cells 1; Protein OCA-T1; POU class 2 homeobox-associating factor 2
• Gene Name: POU2AF2
• UniProt ID: OCAT1_HUMAN
• Pfam ID: PF17721
• Sequence:
  MESVPGDYSKRVYQGVRVKHTVKDLLAEKRSGQTSNSRLNGSVSSSQSPFVQMPGSPVTS
  GYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDY
  RPPALTPNAGSLFSASPLPPLLPPPFPGDPAHFLFRDSWEQTLPDGLSQPDPVSADALLT
  LPPSTSCLSQLESGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFM
  TVSNDLPPKVGPLSPDEEADTGSLHDPSPWVKEDGSIAWGSYECRRAY
• Function: Transcriptional coactivator of POU2F3. This complex drives the development of tuft cells, a rare chemosensory cells that coordinate immune and neural functions within mucosal epithelial tissues.
• Tissue Specificity: Expressed in tuft cells of colon mucosa, as well as in small intestine and thymus .

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of POU domain class 2-associating factor 2 (POU2AF2).	[1]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of POU domain class 2-associating factor 2 (POU2AF2).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of POU domain class 2-associating factor 2 (POU2AF2).	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of POU domain class 2-associating factor 2 (POU2AF2).	[4]

References

• [1] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [2] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.