Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTPHOGIE)
DOT Name | Lens epithelial cell protein LEP503 (LENEP) | ||||
---|---|---|---|---|---|
Gene Name | LENEP | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELL
D |
||||
Function | May play a role in lens epithelial cell differentiation. | ||||
Tissue Specificity | Restricted to lens epithelial cells. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||