Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPNV1ZQ)

DOT Name	Sentan (SNTN)
Synonyms	Protein S100-A1-like; S100 calcium-binding protein A1-like
Gene Name	SNTN
Related Disease	Ovarian neoplasm ( )
UniProt ID	SNTAN_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAI ATTALIFRNSSDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDF EDFMILLLSITVMSDLLQNIRNVKIMK
Function	May be a component of the linker structure that bridges the ciliary membrane and peripheral singlet microtubules.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sentan (SNTN).	[2]
------------------------------------------------------------------------------------

References

1	Intraoperative Diagnosis Support Tool for Serous Ovarian Tumors Based on Microarray Data Using Multicategory Machine Learning.Int J Gynecol Cancer. 2016 Jan;26(1):104-13. doi: 10.1097/IGC.0000000000000566.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.