Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQEM4BT)

• DOT Name: MORN repeat-containing protein 1 (MORN1)
• Gene Name: MORN1
• Related Disease: Polycystic ovarian syndrome
• UniProt ID: MORN1_HUMAN
• Pfam ID: PF02493
• Sequence:
  MAAAGEGTPSSRGPRRDPPRRPPRNGYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGS
  YYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREG
  HGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKG
  QWHSDVFSGLGSMAHCSGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLL
  QDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPFGFECIPYPVS
  SPAAGVPGPRAAKGGAEADVPLPRGDLELHLGALHGQEDTPGGLLARGHAPHCPGACQRV
  EQGCAEFTDVLLGPPPPGYHPFLFLDSLHKKAGGRSRGGLHPRGTPPTAQEPPGGSRPEG
  RATEEQAAAAHLGEYVLMIRDVTTPPFLGRRLPPAFKHLRVVAKRAGQPPHVLEEGPEAS
  SSWQAAHSCTPEPPAPR

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of MORN repeat-containing protein 1 (MORN1).	[2]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of MORN repeat-containing protein 1 (MORN1).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of MORN repeat-containing protein 1 (MORN1).	[5]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of MORN repeat-containing protein 1 (MORN1).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of MORN repeat-containing protein 1 (MORN1).	[6]

References

• [1] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.