Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTQSXM9Z)
DOT Name | Calcitonin gene-related peptide 1 (CALCA) | ||||
---|---|---|---|---|---|
Synonyms | Alpha-type CGRP; Calcitonin gene-related peptide I; CGRP-I | ||||
Gene Name | CALCA | ||||
UniProt ID | |||||
3D Structure | |||||
PDB ID | |||||
Pfam ID | |||||
Sequence |
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ
MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG RRRRDLQA |
||||
Function |
CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. It also elevates platelet cAMP.
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
This DOT Affected the Drug Response of 1 Drug(s)
|
|||||||||||||||||||||||||