Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQVGMG4)

DOT Name	Cation channel sperm-associated auxiliary subunit zeta (CATSPERZ)
Synonyms	CatSper-zeta; CatSperzeta; Testis-expressed protein 40
Gene Name	CATSPERZ
Related Disease	Ovarian cancer ( ) Epithelial ovarian cancer ( ) Neoplasm ( )
UniProt ID	CTSRZ_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNIS KTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKS SSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTK ELQRYIEGLKKRRSKRLYVN
Function	Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation. Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization. Required for a distribution of the CatSper complex in linear quadrilateral nanodomains along the flagellum, maximizing fertilization inside the mammalian female reproductive tract. Together with EFCAB9, associates with the CatSper channel pore and is required for the two-row structure of each single CatSper channel.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Ovarian cancer	DISZJHAP	Definitive	Genetic Variation	[1]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[2]
Neoplasm	DISZKGEW	Limited	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cation channel sperm-associated auxiliary subunit zeta (CATSPERZ).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Cation channel sperm-associated auxiliary subunit zeta (CATSPERZ).	[4]
------------------------------------------------------------------------------------

References

1	Low frequency of ESRRA-C11orf20 fusion gene in ovarian carcinomas.PLoS Biol. 2014 Feb 4;12(2):e1001784. doi: 10.1371/journal.pbio.1001784. eCollection 2014 Feb.
2	ESRRA-C11orf20 is a recurrent gene fusion in serous ovarian carcinoma.PLoS Biol. 2011 Sep;9(9):e1001156. doi: 10.1371/journal.pbio.1001156. Epub 2011 Sep 20.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.