Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS48DQM)

DOT Name Tumor protein p63-regulated gene 1 protein (TPRG1)
Synonyms Protein FAM79B
Gene Name TPRG1
UniProt ID
TPRG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12456
Sequence
MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQP
YISRKYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTL
LICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLS
RWNPWSTEVPYATFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLM
VLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF
Tissue Specificity Expressed in the epidermal layer of the skin.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Tumor protein p63-regulated gene 1 protein (TPRG1). [1]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Tumor protein p63-regulated gene 1 protein (TPRG1). [1]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Tumor protein p63-regulated gene 1 protein (TPRG1). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Tumor protein p63-regulated gene 1 protein (TPRG1). [3]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Tumor protein p63-regulated gene 1 protein (TPRG1). [4]
------------------------------------------------------------------------------------

References

1 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
2 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
3 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
4 BET bromodomain protein inhibition is a therapeutic option for medulloblastoma. Oncotarget. 2013 Nov;4(11):2080-95.