Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT8D6CH)

DOT Name	Beta-defensin 121 (DEFB121)
Synonyms	Beta-defensin 21; DEFB-21; Defensin, beta 121
Gene Name	DEFB121
Related Disease	Stomach cancer ( )
UniProt ID	DB121_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13841
Sequence	MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVK PKLTDTNTSLESTSAV
Function	Has antibacterial activity.
Tissue Specificity	Abundant expression in the male reproductive tract only.
Reactome Pathway	Defensins (R-HSA-1461973 ) Beta defensins (R-HSA-1461957 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Beta-defensin 121 (DEFB121).	[2]
------------------------------------------------------------------------------------

References

1	Genome-wide association study identifies gastric cancer susceptibility loci at 12q24.11-12 and 20q11.21.Cancer Sci. 2018 Dec;109(12):4015-4024. doi: 10.1111/cas.13815. Epub 2018 Oct 31.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.