Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTTU3FKC)
DOT Name | Mitochondrial substrate carrier family protein ancA (ancA?) | ||||
---|---|---|---|---|---|
Synonyms | ADP,ATP carrier protein; ADP/ATP translocase; Adenine nucleotide translocator; ANT | ||||
Gene Name | ancA? | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MSNQKKNDVSSFVKDSLIGGTAGGVSKTIVAPIERVKLLLQVQSASTQIAADKQYKGIVD
CFVRVSKEQGVISLWRGNLANVIRYFPTQALNFAFKDKYKKFFVRHTAKENPTKFFIGNL LSGGAAGATSLLFVYPLDFARTRLAADVGTGSARQFTGLGNCISSIYKRDGLIGLYRGFG VSVGGIFVYRAAFFGGYDTAKGILLGENNKKASFWASWGIAQVVTTIAGVVSYPFDTVRR RMMMQAGRADILYSSTWDCWVKIATREGPTAFFKGALSNAIRGSGGALVLVIYDEIQKLM GFEGGVGSE |
||||
Function |
ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
This DOT Affected the Drug Response of 1 Drug(s)
|
|||||||||||||||||||||||||