Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUFA24U)

DOT Name	Uncharacterized protein C12orf71 (C12ORF71)
Gene Name	C12ORF71
UniProt ID	CL071_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15480
Sequence	MAYSSSNSDIEDDSSKSNSNLSLSVGYFPCEDTPCEDTTSWEDAPSKGPSIHFLPPVQGA WGTERIGRRMKRQDQIQDEPEQFCKLSIFLAWDVDIGSDNTDSRANRLLNGDNLWIDKLP KERTKLSVGKLNNLVQEFQIFLENLKDDDAVFPETAQQDFQLSSGSPPEMVQMISQATAS QRTSAPEISSILSEQPEKDDTPSHTQAQCCLNFGWAFSWLRQRILPSLLRRDHPVNATKS PHRSAPTKRLFHRGKRIQPQETLELGHPI

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Uncharacterized protein C12orf71 (C12ORF71).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Uncharacterized protein C12orf71 (C12ORF71).	[2]
------------------------------------------------------------------------------------

References

1	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.