Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUURZG3)

• DOT Name: Pregnancy-specific beta-1-glycoprotein 6 (PSG6)
• Synonyms: PS-beta-G-6; PSBG-6; Pregnancy-specific glycoprotein 6; Pregnancy-specific beta-1-glycoprotein 10; PS-beta-G-10; PSBG-10; Pregnancy-specific glycoprotein 10; Pregnancy-specific beta-1-glycoprotein 12; PS-beta-G-12; PSBG-12; Pregnancy-specific glycoprotein 12
• Gene Name: PSG6
• Related Disease:
  Gestational trophoblastic neoplasia
  Hydatidiform mole
  Hydatidiform mole, recurrent, 1
• UniProt ID: PSG6_HUMAN
• Pfam ID: PF13895 ; PF13927 ; PF07686
• Sequence:
  MGPLSAPPCTQHITWKGLLLTASLLNFWNLPTTAQVIIEAKPPKVSEGKDVLLLVHNLPQ
  NLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETVYSNASLLIQNVTQEDAGSYT
  LHIIKRGDGTGGVTGYFTVTLYSETPKPSISSSNLNPREVMEAVRLICDPETPDASYLWL
  LNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPM
  PYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRILILPSVT
  RNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLDLSCFADSNPP
  AEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSETASPQV
  TYAGPNTWFQEILLL
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gestational trophoblastic neoplasia	DIS4EJNA	Strong	Altered Expression	[1]
Hydatidiform mole	DISKNP7O	Strong	Altered Expression	[1]
Hydatidiform mole, recurrent, 1	DISXUJWE	Strong	Altered Expression	[1]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Pregnancy-specific beta-1-glycoprotein 6 (PSG6) affects the response to substance of Doxorubicin.	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pregnancy-specific beta-1-glycoprotein 6 (PSG6).	[2]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Pregnancy-specific beta-1-glycoprotein 6 (PSG6).	[3]

References

• [1] Linkage of two human pregnancy-specific beta 1-glycoprotein genes: one is associated with hydatidiform mole.Proc Natl Acad Sci U S A. 1990 Aug;87(15):5822-6. doi: 10.1073/pnas.87.15.5822.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [4] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.