Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTUZZ67L)
DOT Name | Heat shock protein beta-1 (HSPB1) | ||||
---|---|---|---|---|---|
Synonyms | HspB1; 25 kDa IAP; Actin polymerization inhibitor; Heat shock 25 kDa protein; HSP 25; Heat shock 27 kDa protein; HSP 27 | ||||
Gene Name | HSPB1 | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MAERRVPFTFLTSPSWEPFRDWYHGSRLFDQSFGMPHIPEDWYKWPSGSAWPGYFRLLPS
ESALLPAPGSPYGRALSELSSGISEIRQSADSWKVTLDVNHFAPEELVVKTKDNIVEITG KHEEKQDEHGFISRCFTRKYTLPPGVEATAVRSSLSPDGMLTVEAPLPKPAIQSSEITIP VTVEAKKEEPAKK |
||||
Function | Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. | ||||
Tissue Specificity | Smooth, cardiac and skeletal muscle, hardly detectable in fibroblasts or focal contacts. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
This DOT Affected the Drug Response of 1 Drug(s)
|
|||||||||||||||||||||||||