| DOT Name |
V-type proton ATPase subunit G 3 (ATP6V1G3)
|
| Synonyms |
V-ATPase subunit G 3; V-ATPase 13 kDa subunit 3; Vacuolar proton pump subunit G 3 |
| Gene Name |
ATP6V1G3
|
| Related Disease |
- Clear cell renal carcinoma ( )
|
| UniProt ID |
|
| 3D Structure |
|
| Pfam ID |
|
| Sequence |
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQS
KIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
|
| Function |
Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.
|
| Tissue Specificity |
Kidney. |
| KEGG Pathway |
- Oxidative phosphorylation (hsa00190 )
- Metabolic pathways (hsa01100 )
- Phagosome (hsa04145 )
- mTOR sig.ling pathway (hsa04150 )
- Sy.ptic vesicle cycle (hsa04721 )
- Collecting duct acid secretion (hsa04966 )
- Vibrio cholerae infection (hsa05110 )
- Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 )
- Human papillomavirus infection (hsa05165 )
- Rheumatoid arthritis (hsa05323 )
|
| Reactome Pathway |
- Insulin receptor recycling (R-HSA-77387 )
- Transferrin endocytosis and recycling (R-HSA-917977 )
- Amino acids regulate mTORC1 (R-HSA-9639288 )
- Ion channel transport (R-HSA-983712 )
- ROS and RNS production in phagocytes (R-HSA-1222556 )
|
| BioCyc Pathway |
-
- MetaCyc:HS07734-MONOMER
|
|
|
|
|
|
|
