Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW0DE8Q)

• DOT Name: Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C)
• Synonyms: B-cell-activating factor receptor; BAFF receptor; BAFF-R; BLyS receptor 3; CD antigen CD268
• Gene Name: TNFRSF13C
• Related Disease:
  Common variable immunodeficiency
  Immunodeficiency, common variable, 4
• UniProt ID: TR13C_HUMAN
• PDB ID: 1MPV; 1OQE; 1OSX; 2HFG; 3V56; 4V46
• Pfam ID: PF09256
• Sequence:
  MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
  ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
  KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
  PEQQ
• Function: B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
• Tissue Specificity: Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  NF-kappa B sig.ling pathway (hsa04064)
  Intesti.l immune network for IgA production (hsa04672)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Primary immunodeficiency (hsa05340)
• Reactome Pathway:
  TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway (R-HSA-5676594)
  TNFR2 non-canonical NF-kB pathway (R-HSA-5668541)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Common variable immunodeficiency	DISHE7JQ	Supportive	Autosomal dominant	[1]
Immunodeficiency, common variable, 4	DISKEQGK	Limited	Autosomal recessive	[2]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C).	[3]

References

• [1] Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.