Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYWDOA6)

• DOT Name: Germinal center-associated signaling and motility-like protein (GCSAML)
• Gene Name: GCSAML
• UniProt ID: GSAML_HUMAN
• Pfam ID: PF15666
• Sequence:
  MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENEN
  GSGSEEVCYTVINHIPHQRSSLSSNDDGYENIDSLTRKVRQFRERSETEYALLRTSVSRP
  CSCTHEHDYEVVFPH

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Germinal center-associated signaling and motility-like protein (GCSAML).	[1]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Germinal center-associated signaling and motility-like protein (GCSAML).	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Germinal center-associated signaling and motility-like protein (GCSAML).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Germinal center-associated signaling and motility-like protein (GCSAML).	[4]

References

• [1] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [2] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.