Details of the Drug
General Information of Drug (ID: DMOF2C6)
Drug Name |
Ecallantide
|
|||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms |
FOV-2302; Retinal venous occlusion therapy, Fovea; Ecallantide (ophthalmic formulation/retinal disease); Ecallantide (ophthalmic formulation/retinal disease), Dyax/Fovea; DX-88 (ophthalmic formulation/retinal disease), Dyax/Fovea
|
|||||||||||||||||||
Indication |
|
|||||||||||||||||||
Drug Type |
Small molecular drug
|
|||||||||||||||||||
Sequence |
EAMHSFCAFKADDGPCRAAHPRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD
|
|||||||||||||||||||
Structure | ||||||||||||||||||||
3D MOL is unavailable | 2D MOL | |||||||||||||||||||
#Ro5 Violations (Lipinski): 5 | Molecular Weight (mw) | 7054 | ||||||||||||||||||
Topological Polar Surface Area (xlogp) | -27.9 | |||||||||||||||||||
Rotatable Bond Count (rotbonds) | 133 | |||||||||||||||||||
Hydrogen Bond Donor Count (hbonddonor) | 100 | |||||||||||||||||||
Hydrogen Bond Acceptor Count (hbondacc) | 110 | |||||||||||||||||||
ADMET Property |
|
|||||||||||||||||||
Chemical Identifiers |
|
|||||||||||||||||||
Cross-matching ID | ||||||||||||||||||||
Molecular Interaction Atlas of This Drug
Drug Therapeutic Target (DTT) |
|
|||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||
Drug Inactive Ingredient(s) (DIG) and Formulation(s) of This Drug
References
1 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6955). | ||||
---|---|---|---|---|---|
2 | ClinicalTrials.gov (NCT00969293) Study to Assess the Safety and Tolerability of a Single Administration of FOV2302 (Ecallantide) in Patients With Macular Edema Associated With Central Retinal Vein Occlusion. U.S. National Institutes of Health. | ||||
3 | FDA approval: ado-trastuzumab emtansine for the treatment of patients with HER2-positive metastatic breast cancer. Clin Cancer Res. 2014 Sep 1;20(17):4436-41. | ||||
4 | Farkas H, Varga L: Ecallantide is a novel treatment for attacks of hereditary angioedema due to C1 inhibitor deficiency. Clin Cosmet Investig Dermatol. 2011;4:61-8. doi: 10.2147/CCID.S10322. Epub 2011 May 31. | ||||
5 | Kim ES: Lusutrombopag: First Global Approval. Drugs. 2016 Jan;76(1):155-8. doi: 10.1007/s40265-015-0525-4. | ||||
6 | Ecallantide (DX-88), a plasma kallikrein inhibitor for the treatment of hereditary angioedema and the prevention of blood loss in on-pump cardiothoracic surgery. Expert Opin Biol Ther. 2008 Aug;8(8):1187-99. | ||||
7 | Characterization of a class of peptide boronates with neutral P1 side chains as highly selective inhibitors of thrombin. J Med Chem. 1995 Apr 28;38(9):1511-22. | ||||
8 | A new broad spectrum inhibitor of esteroproteases, 4-(2-carboxyethyl) phenyl-trans-4-aminomethyl cyclohexane carboxylate hydrochloride (DV 1006). Tohoku J Exp Med. 1972 Mar;106(3):233-48. | ||||
9 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | ||||
10 | Serine protease inhibitors to treat inflammation: a patent review (2011-2016).Expert Opin Ther Pat. 2018 Feb;28(2):93-110. | ||||
11 | 2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89. | ||||
12 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020 | ||||
13 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | ||||
14 | Clinical pipeline report, company report or official report of KalVista Pharmaceuticals. | ||||
15 | Clinical pipeline report, company report or official report of Oxurion. | ||||
16 | N-benzoylpyrazoles are novel small-molecule inhibitors of human neutrophil elastase. J Med Chem. 2007 Oct 4;50(20):4928-38. | ||||
17 | Novel 3-carboxamide-coumarins as potent and selective FXIIa inhibitors. J Med Chem. 2008 Jun 12;51(11):3077-80. | ||||