Details of the Drug
General Information of Drug (ID: DMUH012)
Drug Name |
PMID26911565-peptide-P9
|
||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms | PMID26911565-P9 | ||||||||||||||||||||||||||
Indication |
|
||||||||||||||||||||||||||
Therapeutic Class |
Antiviral Agents
|
||||||||||||||||||||||||||
Drug Type |
Protein/peptide drug
|
||||||||||||||||||||||||||
Sequence |
NGAICWGPCPTAFRQIGNCGHFKVRCCKIR
|
||||||||||||||||||||||||||
Cross-matching ID | |||||||||||||||||||||||||||
Repurposed Drugs (RPD) | Click to Jump to the Detailed RPD Information of This Drug | ||||||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
Drug Therapeutic Target (DTT) |
|
|||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||