Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT0EQPW)

DTP Name Concentrative nucleoside transporter 1 (SLC28A1)
Gene Name SLC28A1
UniProt ID
O00337 (S28A1_HUMAN)
VARIDT ID
DTD0244
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms CNT 1; CNT1; Na(+)/nucleoside cotransporter 1; SLC28A1; Sodium-coupled nucleoside transporter 1; Sodium/nucleoside cotransporter 1; Solute carrier family 28 member 1; hCNT1
DTP Family Concentrative Nucleoside Transporter (CNT) Family ;
Tissue Specificity Expressed in kidney.
Sequence
MENDPSRRRESISLTPVAKGLENMGADFLESLEEGQLPRSDLSPAEIRSSWSEAAPKPFS
RWRNLQPALRARSFCREHMQLFRWIGTGLLCTGLSAFLLVACLLDFQRALALFVLTCVVL
TFLGHRLLKRLLGPKLRRFLKPQGHPRLLLWFKRGLALAAFLGLVLWLSLDTSQRPEQLV
SFAGICVFVALLFACSKHHCAVSWRAVSWGLGLQFVLGLLVIRTEPGFIAFEWLGEQIRI
FLSYTKAGSSFVFGEALVKDVFAFQVLPIIVFFSCVISVLYHVGLMQWVILKIAWLMQVT
MGTTATETLSVAGNIFVSQTEAPLLIRPYLADMTLSEVHVVMTGGYATIAGSLLGAYISF
GIDATSLIAASVMAAPCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAI
SVKVVANIAANLIAFLAVLDFINAALSWLGDMVDIQGLSFQLICSYILRPVAFLMGVAWE
DCPVVAELLGIKLFLNEFVAYQDLSKYKQRRLAGAEEWVGDRKQWISVRAEVLTTFALCG
FANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILYMPRGAEVDC
MSLLNTTLSSSSFEIYQCCREAFQSVNPEFSPEALDNCCRFYNHTICAQ
Function
This sodium-dependent transporter exhibits the transport characteristics of the nucleoside transport system cit or N2 subtype (N2/cit) (selective for pyrimidine nucleosides and adenosine). It also transports the antiviral pyrimidine nucleoside analogs 3'-azido-3'-deoxythymidine (AZT) and 2',3'-dideoxycytidine (ddC). It may be involved in the intestinal absorption and renal handling of pyrimidine nucleoside analogs used to treat acquired immunodeficiency syndrome (AIDS). It has the following selective inhibition: adenosine, thymidine, cytidine, uridine >> guanosine, inosine.
Endogenous Substrate(s) 5'-deoxy-5'-fluorouridine; Na+
TCDB ID
2.A.41.2.3
Gene ID
9154
Reactome Pathway
Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane (R-HSA-83936 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
4 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cytarabine DMZD5QR Acute lymphoblastic leukaemia 2A85 Approved [1]
Gemcitabine DMSE3I7 Anterior urethra cancer Approved [2]
Trifluridine DMG2YBD Herpetic keratitis 1F00.10 Approved [3]
Uridine DMQTREB Depression 6A70-6A7Z Approved [4]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.23E-03 8.13E-02 4.78E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.32E-01 -8.49E-03 -3.49E-02
Alopecia ED70 Skin from scalp 3.15E-01 -3.72E-02 -1.29E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.79E-01 -2.43E-02 -1.68E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.98E-01 -4.65E-02 -5.15E-01
Aortic stenosis BB70 Calcified aortic valve 7.57E-01 -1.30E-02 -1.86E-02
Apnea 7A40 Hyperplastic tonsil 4.23E-01 -1.36E-01 -8.13E-01
Arthropathy FA00-FA5Z Peripheral blood 9.69E-01 3.87E-02 2.74E-01
Asthma CA23 Nasal and bronchial airway 3.56E-01 -6.31E-02 -1.28E-01
Atopic dermatitis EA80 Skin 9.79E-01 -1.38E-02 -1.70E-01
Autism 6A02 Whole blood 3.37E-01 -1.15E-01 -7.13E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.89E-02 -2.06E-01 -1.22E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.37E-01 -7.79E-03 -5.38E-02
Bacterial infection of gingival 1C1H Gingival tissue 2.61E-02 8.01E-02 3.45E-01
Batten disease 5C56.1 Whole blood 9.26E-01 1.55E-02 1.15E-01
Behcet's disease 4A62 Peripheral blood 4.04E-01 4.72E-02 3.89E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.84E-01 1.54E-02 1.09E-01
Bladder cancer 2C94 Bladder tissue 1.31E-03 5.26E-01 2.13E+00
Breast cancer 2C60-2C6Z Breast tissue 1.66E-07 -1.03E-01 -3.45E-01
Cardioembolic stroke 8B11.20 Whole blood 4.97E-01 -9.98E-03 -5.33E-02
Cervical cancer 2C77 Cervical tissue 6.57E-01 4.68E-02 1.94E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.86E-01 -9.05E-03 -3.99E-02
Chronic hepatitis C 1E51.1 Whole blood 6.39E-01 4.45E-02 2.80E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.49E-03 1.01E-01 5.47E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.96E-03 9.96E-02 5.11E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.72E-01 -1.15E-01 -1.26E+00
Colon cancer 2B90 Colon tissue 2.14E-02 -4.77E-02 -1.43E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.55E-01 -2.01E-01 -9.28E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.50E-01 -6.24E-02 -3.71E-01
Endometriosis GA10 Endometrium tissue 3.17E-01 2.14E-01 5.76E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.20E-01 4.46E-02 3.24E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.11E-01 -1.07E-01 -5.69E-01
Gastric cancer 2B72 Gastric tissue 1.33E-01 -2.72E-01 -1.64E+00
Glioblastopma 2A00.00 Nervous tissue 1.25E-15 -1.22E-01 -4.48E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.82E-08 -9.35E-01 -3.58E+00
Head and neck cancer 2D42 Head and neck tissue 3.89E-01 7.02E-03 3.50E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.79E-02 -1.52E-01 -8.39E-01
Huntington's disease 8A01.10 Whole blood 4.57E-01 -7.48E-02 -5.36E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.02E-01 4.15E-02 1.92E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.85E-01 3.79E-02 6.01E-01
Influenza 1.00E+30 Whole blood 8.54E-02 4.36E-01 1.93E+00
Interstitial cystitis GC00.3 Bladder tissue 5.18E-01 -2.28E-03 -3.37E-02
Intracranial aneurysm 8B01.0 Intracranial artery 5.73E-01 -1.10E-01 -7.30E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.07E-01 1.82E-01 5.40E-01
Ischemic stroke 8B11 Peripheral blood 5.89E-02 7.88E-02 5.06E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.48E-01 -1.33E-02 -4.97E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 3.39E-02 3.07E-01 1.25E+00
Lateral sclerosis 8B60.4 Skin 4.86E-01 4.89E-02 5.66E-01
Liver cancer 2C12.0 Liver tissue 1.45E-27 -1.56E+00 -3.44E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.58E-05 -1.58E+00 -3.52E+00
Lung cancer 2C25 Lung tissue 1.08E-01 1.21E-03 6.22E-03
Lupus erythematosus 4A40 Whole blood 1.97E-02 -1.17E-01 -3.04E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.61E-01 1.06E-03 5.21E-03
Major depressive disorder 6A70-6A7Z Hippocampus 3.82E-01 3.88E-02 2.66E-01
Melanoma 2C30 Skin 2.79E-01 -1.21E-01 -3.24E-01
Multiple myeloma 2A83.1 Bone marrow 9.66E-05 -4.28E-01 -2.71E+00
Multiple myeloma 2A83.1 Peripheral blood 1.28E-01 1.13E-01 6.23E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.88E-01 4.79E-02 2.20E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.71E-01 -4.58E-03 -2.88E-02
Myelofibrosis 2A20.2 Whole blood 1.18E-01 8.62E-02 6.26E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.34E-01 1.35E-01 3.89E-01
Myopathy 8C70.6 Muscle tissue 4.22E-02 -1.60E-01 -1.62E+00
Neonatal sepsis KA60 Whole blood 2.76E-01 3.41E-02 1.84E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.71E-04 -5.48E-01 -1.94E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.00E-01 2.44E-01 5.41E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.60E-01 1.09E-01 1.39E+00
Olive pollen allergy CA08.00 Peripheral blood 1.59E-01 2.15E-01 1.05E+00
Oral cancer 2B6E Oral tissue 1.99E-10 -5.31E-01 -2.00E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.66E-03 -3.12E-01 -1.17E+00
Osteoporosis FB83.1 Bone marrow 8.06E-02 1.44E-01 1.46E+00
Ovarian cancer 2C73 Ovarian tissue 2.59E-01 -7.40E-02 -1.81E-01
Pancreatic cancer 2C10 Pancreas 2.99E-02 -3.24E-01 -1.02E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.60E-01 -3.53E-02 -1.69E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.90E-02 -2.33E-02 -1.35E-01
Pituitary cancer 2D12 Pituitary tissue 1.68E-01 6.98E-02 2.47E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.58E-01 1.26E-01 4.48E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.89E-01 -1.76E-01 -1.20E+00
Polycythemia vera 2A20.4 Whole blood 2.19E-05 1.24E-01 8.26E-01
Pompe disease 5C51.3 Biceps muscle 2.18E-01 -2.37E-01 -1.31E+00
Preterm birth KA21.4Z Myometrium 4.86E-01 7.31E-03 9.80E-02
Prostate cancer 2C82 Prostate 3.65E-01 1.30E-01 2.78E-01
Psoriasis EA90 Skin 2.16E-02 -1.00E-02 -4.26E-02
Rectal cancer 2B92 Rectal colon tissue 4.86E-01 -3.19E-02 -1.85E-01
Renal cancer 2C90-2C91 Kidney 8.85E-01 -1.86E-01 -1.74E-01
Retinoblastoma 2D02.2 Uvea 2.15E-05 -4.97E-01 -3.20E+00
Rheumatoid arthritis FA20 Synovial tissue 3.97E-04 -5.65E-01 -2.14E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.28E-01 3.01E-03 2.30E-02
Schizophrenia 6A20 Prefrontal cortex 1.54E-01 3.12E-02 1.14E-01
Schizophrenia 6A20 Superior temporal cortex 6.80E-01 3.35E-02 2.47E-01
Scleroderma 4A42.Z Whole blood 4.83E-02 8.91E-02 4.83E-01
Seizure 8A60-8A6Z Whole blood 7.77E-01 -7.36E-02 -3.61E-01
Sensitive skin EK0Z Skin 7.05E-01 -1.49E-03 -1.31E-02
Sepsis with septic shock 1G41 Whole blood 1.37E-04 3.66E-02 1.69E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.96E-01 3.42E-01 1.11E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.30E-01 1.33E-01 4.44E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.58E-01 1.56E-01 1.52E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.25E-01 -1.28E-01 -5.35E-01
Skin cancer 2C30-2C3Z Skin 5.31E-03 7.20E-02 2.75E-01
Thrombocythemia 3B63 Whole blood 2.04E-01 4.75E-02 3.20E-01
Thrombocytopenia 3B64 Whole blood 6.71E-01 -6.65E-02 -3.18E-01
Thyroid cancer 2D10 Thyroid 5.29E-02 6.47E-02 2.80E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.96E-07 -4.34E-01 -2.35E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.12E-02 1.96E-01 2.14E+00
Type 2 diabetes 5A11 Liver tissue 2.58E-01 2.80E-01 4.71E-01
Ureter cancer 2C92 Urothelium 7.86E-01 -6.38E-02 -3.45E-01
Uterine cancer 2C78 Endometrium tissue 6.67E-01 7.31E-03 2.64E-02
Vitiligo ED63.0 Skin 7.26E-01 1.26E-02 7.82E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 FLT3 is implicated in cytarabine transport by human equilibrative nucleoside transporter 1 in pediatric acute leukemia. Oncotarget. 2016 Aug 2;7(31):49786-49799.
2 Pancreatic Cancer Chemoresistance to Gemcitabine. Cancers (Basel). 2017 Nov 16;9(11).
3 Lonsurf, INN-trifluridine/tipiracil.
4 Electrophysiological recordings of CNT1 (SLC28A1) activity on Nanions SURFE2R N1.