Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT0NSKB)

DTP Name Proton myo-inositol cotransporter (SLC2A13)
Gene Name SLC2A13
UniProt ID
Q96QE2 (MYCT_HUMAN)
VARIDT ID
DTD0255
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms H(+)-myo-inositol cotransporter; H(+)-myo-inositol symporter; Hmit; SLC2A13; Solute carrier family 2 member 13
DTP Family Major Facilitator Superfamily (MFS)
Sugar Porter (SP) Family
Tissue Specificity Predominantly expressed in the brain.
Sequence
MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGG
VGDLERAARRQFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQ
ELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLV
VGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRY
MLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIE
EEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDD
RLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAW
GRCENETKFKTEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWA
RSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGK
KLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Function This is a H(+)-myo-inositol cotransporter. Its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and NRF2 pathway.
Endogenous Substrate(s) Myoinositol; H+; Inositol
TCDB ID
2.A.1.1.25
Gene ID
114134
Reactome Pathway
Inositol transporters (R-HSA-429593 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.53E-01 -1.21E-02 -9.91E-02
Adrenocortical carcinoma 2D11.Z Kidney 1.03E-03 4.35E-01 1.38E+00
Alopecia ED70 Skin from scalp 2.60E-01 1.07E-01 2.78E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.56E-02 -9.01E-02 -2.19E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.99E-01 -2.77E-02 -2.92E-01
Aortic stenosis BB70 Calcified aortic valve 8.14E-01 -7.16E-02 -1.61E-01
Apnea 7A40 Hyperplastic tonsil 1.15E-01 -1.21E-01 -6.05E-01
Arthropathy FA00-FA5Z Peripheral blood 1.21E-01 -8.93E-02 -8.50E-01
Asthma CA23 Nasal and bronchial airway 9.24E-01 7.92E-02 1.05E-01
Atopic dermatitis EA80 Skin 8.29E-02 -9.53E-02 -4.56E-01
Autism 6A02 Whole blood 3.33E-01 -4.81E-02 -2.76E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.29E-01 -1.06E-01 -7.73E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.15E-01 -4.04E-02 -6.72E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.38E-04 -1.25E-01 -3.72E-01
Batten disease 5C56.1 Whole blood 7.36E-01 -4.72E-02 -3.08E-01
Behcet's disease 4A62 Peripheral blood 1.26E-01 -8.47E-02 -3.82E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.12E-01 -4.17E-02 -7.29E-02
Bladder cancer 2C94 Bladder tissue 2.72E-01 2.27E-01 7.15E-01
Breast cancer 2C60-2C6Z Breast tissue 7.53E-01 -2.89E-04 -9.17E-04
Cardioembolic stroke 8B11.20 Whole blood 1.48E-02 2.23E-01 7.47E-01
Cervical cancer 2C77 Cervical tissue 6.58E-01 5.85E-02 2.33E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.65E-01 -2.01E-02 -1.72E-01
Chronic hepatitis C 1E51.1 Whole blood 8.01E-01 2.42E-02 1.32E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.56E-01 -1.45E-02 -3.82E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.76E-04 -2.24E-01 -6.39E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.35E-01 2.33E-01 8.22E-01
Colon cancer 2B90 Colon tissue 3.94E-19 -2.92E-01 -7.90E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.05E-01 -3.68E-02 -5.83E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.14E-01 2.02E-03 9.90E-03
Endometriosis GA10 Endometrium tissue 6.50E-03 1.78E-02 6.89E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.39E-01 -4.05E-02 -3.38E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.31E-01 8.35E-02 4.95E-01
Gastric cancer 2B72 Gastric tissue 9.39E-01 -1.70E-03 -4.16E-03
Glioblastopma 2A00.00 Nervous tissue 4.69E-17 -5.05E-01 -7.08E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.04E-07 2.54E+00 3.30E+00
Head and neck cancer 2D42 Head and neck tissue 4.23E-06 -1.83E-01 -5.02E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.57E-01 -9.82E-02 -2.69E-01
Huntington's disease 8A01.10 Whole blood 2.34E-01 -2.39E-02 -2.23E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.29E-02 -2.91E-01 -2.80E+00
Immunodeficiency 4A00-4A20 Peripheral blood 6.96E-01 1.16E-02 1.08E-01
Influenza 1.00E+30 Whole blood 4.63E-01 5.74E-02 3.08E-01
Interstitial cystitis GC00.3 Bladder tissue 2.90E-02 3.95E-01 1.34E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.60E-01 -1.91E-01 -8.01E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.71E-02 2.34E-01 5.27E-01
Ischemic stroke 8B11 Peripheral blood 4.09E-01 -5.08E-02 -4.09E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.36E-01 5.41E-02 8.97E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 8.30E-01 5.10E-02 1.89E-01
Lateral sclerosis 8B60.4 Skin 1.25E-01 1.22E-01 1.23E+00
Liver cancer 2C12.0 Liver tissue 2.57E-02 -1.92E-01 -8.66E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.17E-03 -2.76E-01 -8.48E-01
Lung cancer 2C25 Lung tissue 1.55E-01 -5.45E-02 -1.63E-01
Lupus erythematosus 4A40 Whole blood 2.46E-08 1.03E-01 2.39E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.10E-01 1.79E-02 4.44E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.39E-01 -1.37E-01 -2.47E-01
Melanoma 2C30 Skin 5.04E-03 2.21E-01 3.28E-01
Multiple myeloma 2A83.1 Bone marrow 4.76E-03 -3.39E-01 -1.50E+00
Multiple myeloma 2A83.1 Peripheral blood 9.10E-01 -5.31E-02 -2.58E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.14E-01 1.18E-01 4.20E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.23E-01 -2.56E-02 -1.64E-01
Myelofibrosis 2A20.2 Whole blood 7.57E-01 -1.40E-02 -4.77E-02
Myocardial infarction BA41-BA50 Peripheral blood 8.31E-02 -9.46E-01 -9.78E-01
Myopathy 8C70.6 Muscle tissue 5.97E-01 2.63E-02 1.97E-01
Neonatal sepsis KA60 Whole blood 1.16E-01 3.07E-02 1.61E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.88E-01 -1.58E-01 -7.18E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.72E-01 1.37E-01 1.20E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.46E-01 7.24E-02 5.37E-01
Olive pollen allergy CA08.00 Peripheral blood 8.56E-01 -4.37E-03 -1.90E-02
Oral cancer 2B6E Oral tissue 1.63E-02 -1.57E-01 -9.43E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.96E-01 -7.80E-02 -1.71E-01
Osteoporosis FB83.1 Bone marrow 1.02E-01 1.92E-01 1.37E+00
Ovarian cancer 2C73 Ovarian tissue 4.56E-01 -1.48E-02 -7.14E-02
Pancreatic cancer 2C10 Pancreas 6.74E-01 -8.10E-02 -3.63E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.11E-02 -3.24E-01 -3.84E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.59E-01 8.67E-03 3.75E-02
Pituitary cancer 2D12 Pituitary tissue 1.28E-01 -5.22E-01 -6.76E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.99E-01 1.18E-01 2.23E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.36E-01 -1.73E-01 -5.64E-01
Polycythemia vera 2A20.4 Whole blood 5.81E-02 8.21E-02 3.06E-01
Pompe disease 5C51.3 Biceps muscle 3.21E-01 2.99E-01 6.84E-01
Preterm birth KA21.4Z Myometrium 2.25E-03 -1.72E-01 -1.90E+00
Prostate cancer 2C82 Prostate 9.91E-04 1.50E+00 1.19E+00
Psoriasis EA90 Skin 1.61E-02 -1.67E-01 -3.27E-01
Rectal cancer 2B92 Rectal colon tissue 2.15E-01 1.13E-01 2.82E-01
Renal cancer 2C90-2C91 Kidney 2.55E-02 -2.27E-01 -1.11E+00
Retinoblastoma 2D02.2 Uvea 1.25E-02 2.81E-01 3.09E+00
Rheumatoid arthritis FA20 Synovial tissue 7.38E-02 -4.00E-01 -6.64E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.08E-01 -3.04E-02 -1.64E-01
Schizophrenia 6A20 Prefrontal cortex 6.59E-01 1.42E-02 2.16E-02
Schizophrenia 6A20 Superior temporal cortex 4.69E-01 4.15E-02 2.73E-01
Scleroderma 4A42.Z Whole blood 3.76E-01 -5.86E-02 -5.85E-01
Seizure 8A60-8A6Z Whole blood 2.99E-01 -1.03E-01 -4.80E-01
Sensitive skin EK0Z Skin 7.65E-01 -4.39E-02 -2.60E-01
Sepsis with septic shock 1G41 Whole blood 1.63E-01 -1.01E-02 -5.27E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.54E-02 1.69E-01 1.08E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.06E-01 7.40E-02 7.18E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.21E-01 1.95E-01 1.28E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.54E-01 -2.96E-02 -4.72E-01
Skin cancer 2C30-2C3Z Skin 3.60E-15 2.47E-01 5.30E-01
Thrombocythemia 3B63 Whole blood 2.10E-01 1.08E-01 3.45E-01
Thrombocytopenia 3B64 Whole blood 8.17E-01 1.16E-01 1.85E-01
Thyroid cancer 2D10 Thyroid 7.07E-10 1.30E-01 7.11E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.30E-03 2.18E-01 1.69E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.82E-01 -4.19E-01 -5.66E-01
Type 2 diabetes 5A11 Liver tissue 7.63E-01 -1.91E-02 -7.40E-02
Ureter cancer 2C92 Urothelium 3.81E-01 -4.63E-02 -2.20E-01
Uterine cancer 2C78 Endometrium tissue 4.02E-01 -2.03E-02 -6.59E-02
Vitiligo ED63.0 Skin 9.85E-01 -1.13E-01 -2.32E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases