Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT0TZPS)

DTP Name Anion transporter/exchanger protein 9 (SLC26A9)
Gene Name SLC26A9
UniProt ID
Q7LBE3 (S26A9_HUMAN)
VARIDT ID
DTD0237
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Solute carrier family 26 member 9; SLC26A9
DTP Family Sulfate Permease (SULP) Family ;
Tissue Specificity Predominantly expressed in lung at the luminal side of the bronchiolar and alveolar epithelium of lung. To a lower extent, also expressed in pancreas and prostate.
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLS
WLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEAERLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTGPGSIVFT
FIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGG
CKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGIYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYF
ANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQ
DFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFV
TFHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGS
LECKHVFPSIHDAVLFAQANARDVTPGHNFQGAPGDAELSLYDSEEDIRSYWDLEQEMFG
SMFHAETLTAL
Function
This DIDS- and thiosulfate- sensitive anion exchanger mediating chloride, sulfate and oxalate transport and also mediates chloride/bicarbonate exchange or chloride-independent bicarbonate extrusion thus assuring bicarbonate secretion.
Endogenous Substrate(s) Anions
TCDB ID
2.A.53.2.15
Gene ID
115019
KEGG Pathway
Mineral absorption (hsa04978 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Reactome Pathway
Multifunctional anion exchangers (R-HSA-427601 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
BICARBONATE DMT5E36 Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.65E-01 8.47E-03 4.09E-02
Adrenocortical carcinoma 2D11.Z Kidney 8.06E-01 -9.24E-02 -5.20E-01
Alopecia ED70 Skin from scalp 2.17E-01 -6.08E-02 -1.34E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.24E-03 1.90E-01 5.85E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.54E-01 -8.36E-02 -9.47E-01
Aortic stenosis BB70 Calcified aortic valve 7.19E-01 1.87E-02 3.33E-02
Apnea 7A40 Hyperplastic tonsil 4.11E-01 -1.01E+00 -5.98E-01
Arthropathy FA00-FA5Z Peripheral blood 8.71E-01 4.53E-02 2.35E-01
Asthma CA23 Nasal and bronchial airway 6.58E-01 -1.09E-01 -1.71E-01
Atopic dermatitis EA80 Skin 4.68E-02 2.34E-01 5.53E-01
Autism 6A02 Whole blood 9.78E-01 -2.33E-04 -1.08E-03
Autoimmune uveitis 9A96 Peripheral monocyte 1.00E-01 -2.08E-01 -1.12E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.04E-01 8.80E-02 7.55E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.29E-01 1.41E-01 1.81E-01
Batten disease 5C56.1 Whole blood 9.37E-01 3.38E-03 1.73E-02
Behcet's disease 4A62 Peripheral blood 5.37E-01 4.97E-02 1.72E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.97E-02 -5.86E-02 -2.70E-01
Bladder cancer 2C94 Bladder tissue 1.05E-04 6.61E-01 2.74E+00
Breast cancer 2C60-2C6Z Breast tissue 1.92E-17 5.87E-02 2.55E-01
Cardioembolic stroke 8B11.20 Whole blood 1.10E-03 1.21E-01 7.49E-01
Cervical cancer 2C77 Cervical tissue 5.34E-01 1.81E-02 3.71E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.56E-01 5.95E-02 2.14E-01
Chronic hepatitis C 1E51.1 Whole blood 7.01E-01 4.86E-02 2.23E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.11E-01 -2.07E-01 -2.80E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.28E-01 4.14E-02 6.73E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.79E-01 3.48E-03 1.37E-02
Colon cancer 2B90 Colon tissue 4.06E-16 1.00E-01 4.55E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.69E-01 4.68E-02 5.06E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.47E-01 -1.00E-01 -3.81E-01
Endometriosis GA10 Endometrium tissue 6.51E-02 9.57E-02 4.95E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.13E-01 4.08E-02 3.33E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.52E-04 -2.77E-01 -1.23E+00
Gastric cancer 2B72 Gastric tissue 1.23E-01 -4.42E+00 -2.29E+00
Glioblastopma 2A00.00 Nervous tissue 3.32E-06 -1.04E-01 -2.33E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.29E-02 -6.03E-01 -6.73E-01
Head and neck cancer 2D42 Head and neck tissue 7.71E-01 -1.04E-01 -1.19E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.90E-02 4.31E-01 7.17E-01
Huntington's disease 8A01.10 Whole blood 6.96E-01 7.00E-02 4.52E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.32E-01 -1.22E-01 -2.25E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.19E-01 2.32E-03 1.44E-02
Influenza 1.00E+30 Whole blood 6.70E-01 -6.01E-01 -7.98E-01
Interstitial cystitis GC00.3 Bladder tissue 1.95E-01 1.70E-01 8.89E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.65E-04 2.13E-01 1.09E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.25E-01 9.72E-02 2.82E-01
Ischemic stroke 8B11 Peripheral blood 9.67E-01 7.84E-02 2.61E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.32E-01 -6.20E-02 -2.66E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.24E-02 4.88E-01 1.65E+00
Lateral sclerosis 8B60.4 Skin 6.40E-01 -3.43E-02 -2.27E-01
Liver cancer 2C12.0 Liver tissue 6.49E-01 -6.73E-02 -2.59E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.69E-01 -1.10E-02 -5.44E-02
Lung cancer 2C25 Lung tissue 9.30E-44 -1.33E+00 -1.70E+00
Lupus erythematosus 4A40 Whole blood 1.88E-01 -6.45E-02 -2.16E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.04E-02 7.96E-02 3.19E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.21E-02 -9.10E-02 -4.15E-01
Melanoma 2C30 Skin 1.55E-03 -1.95E+00 -1.18E+00
Multiple myeloma 2A83.1 Bone marrow 4.47E-03 -4.16E-01 -1.80E+00
Multiple myeloma 2A83.1 Peripheral blood 3.22E-01 -8.88E-02 -4.32E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.10E-01 2.19E-01 7.96E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.86E-01 9.63E-03 5.98E-02
Myelofibrosis 2A20.2 Whole blood 1.45E-02 -1.36E-01 -9.41E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.45E-02 1.61E-01 3.83E-01
Myopathy 8C70.6 Muscle tissue 7.83E-01 7.55E-02 7.51E-02
Neonatal sepsis KA60 Whole blood 1.33E-01 -6.71E-02 -2.98E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.78E-05 -7.13E-01 -2.50E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.82E-01 -9.83E-03 -5.66E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.83E-01 3.31E-02 1.11E-01
Olive pollen allergy CA08.00 Peripheral blood 9.82E-01 -1.27E-01 -4.76E-01
Oral cancer 2B6E Oral tissue 2.57E-02 -2.34E-01 -1.47E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.11E-01 1.11E-01 1.76E-01
Osteoporosis FB83.1 Bone marrow 5.17E-01 4.00E-02 2.72E-01
Ovarian cancer 2C73 Ovarian tissue 1.39E-01 5.94E-02 1.27E-01
Pancreatic cancer 2C10 Pancreas 3.29E-06 1.42E+00 1.66E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.07E-01 1.19E-01 3.34E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.84E-01 -4.50E-03 -2.95E-02
Pituitary cancer 2D12 Pituitary tissue 4.00E-03 6.38E-01 2.05E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.82E-04 1.18E+00 4.99E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.29E-02 -2.57E-01 -4.75E-01
Polycythemia vera 2A20.4 Whole blood 5.92E-03 -5.75E-02 -3.96E-01
Pompe disease 5C51.3 Biceps muscle 1.36E-05 3.02E+00 2.88E+00
Preterm birth KA21.4Z Myometrium 3.89E-02 -1.09E-01 -6.32E-01
Prostate cancer 2C82 Prostate 8.84E-01 -2.93E-02 -8.65E-02
Psoriasis EA90 Skin 3.47E-53 2.33E+00 4.18E+00
Rectal cancer 2B92 Rectal colon tissue 5.89E-02 -3.98E-03 -3.16E-02
Renal cancer 2C90-2C91 Kidney 1.55E-01 -1.44E+00 -1.03E+00
Retinoblastoma 2D02.2 Uvea 8.76E-02 -1.10E-01 -8.00E-01
Rheumatoid arthritis FA20 Synovial tissue 1.53E-01 -1.59E-01 -3.74E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.17E-01 5.36E-02 2.05E-01
Schizophrenia 6A20 Prefrontal cortex 8.14E-01 -4.89E-03 -2.07E-02
Schizophrenia 6A20 Superior temporal cortex 1.12E-01 -2.94E-02 -1.96E-01
Scleroderma 4A42.Z Whole blood 3.40E-01 3.88E-02 1.58E-01
Seizure 8A60-8A6Z Whole blood 7.52E-01 1.02E-01 6.03E-01
Sensitive skin EK0Z Skin 9.11E-01 -1.20E-01 -2.51E-01
Sepsis with septic shock 1G41 Whole blood 7.90E-02 2.20E-02 9.79E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.36E-01 2.48E-02 1.16E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.83E-01 5.07E-02 3.83E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.53E-02 2.70E-01 3.07E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.38E-03 1.23E+00 5.11E+00
Skin cancer 2C30-2C3Z Skin 1.26E-19 -8.06E-01 -1.15E+00
Thrombocythemia 3B63 Whole blood 1.83E-02 -1.31E-01 -8.23E-01
Thrombocytopenia 3B64 Whole blood 9.86E-01 -6.45E-02 -3.15E-01
Thyroid cancer 2D10 Thyroid 1.26E-11 -5.32E-01 -1.09E+00
Tibial muscular dystrophy 8C75 Muscle tissue 9.22E-04 -1.16E+00 -9.19E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.39E-01 -1.69E-01 -6.22E-01
Type 2 diabetes 5A11 Liver tissue 5.35E-01 5.50E-02 7.38E-01
Ureter cancer 2C92 Urothelium 8.52E-02 -5.40E-02 -2.02E-01
Uterine cancer 2C78 Endometrium tissue 9.73E-14 4.21E-01 7.61E-01
Vitiligo ED63.0 Skin 9.84E-01 1.96E-02 3.10E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 26 member 9 (SLC26A9) DTT Info
DTP DTT Type Literature-reported

References

1 SLC26A9 is expressed in gastric surface epithelial cells, mediates Cl-/HCO3- exchange, and is inhibited by NH4+. Am J Physiol Cell Physiol. 2005 Aug;289(2):C493-505.