Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT1CP40)

DTP Name Sodium/glucose cotransporter 4 (SLC5A9)
Gene Name SLC5A9
UniProt ID
Q2M3M2 (SC5A9_HUMAN)
VARIDT ID
DTD0429
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Na(+)/glucose cotransporter 4; SGLT4; SLC5A9; Solute carrier family 5 member 9; hSGLT4
DTP Family Solute:Sodium Symporter (SSS) Family ;
Tissue Specificity Expressed in the small intestine, kidney andliver.
Sequence
MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIAVGIWSSIRAS
RGTIGGYFLAGRSMSWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATWLLLA
LGWVFVPVYIAAGVVTMPQYLKKRFGGQRIQVYMSVLSLILYIFTKISTDIFSGALFIQM
ALGWNLYLSTGILLVVTAVYTIAGGLMAVIYTDALQTVIMVGGALVLMFLGFQDVGWYPG
LEQRYRQAIPNVTVPNTTCHLPRPDAFHILRDPVSGDIPWPGLIFGLTVLATWCWCTDQV
IVQRSLSAKSLSHAKGGSVLGGYLKILPMFFIVMPGMISRALFPDEVGCVDPDVCQRICG
ARVGCSNIAYPKLVMALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFTIDVWQRFRRK
STEQELMVVGRVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIF
CKRVTEPGAFWGLVFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGL
TAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHESTPEISERPAGECPAGGGA
AENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRH
VCNINAVLLLAINIFLWGYFA
Function This sodium-dependent transporter involved in transport of D-mannose, D-glucose and D-fructose.
Endogenous Substrate(s) Na+
TCDB ID
2.A.21.3.17
Gene ID
200010
Reactome Pathway
Cellular hexose transport (R-HSA-189200 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
2 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
2-deoxyglucose DMIAHVU Solid tumour/cancer 2A00-2F9Z Approved [1]
Fructose DM43AN2 Vomiting MD90 Approved [1]
------------------------------------------------------------------------------------
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-mannose DMT6X03 Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.76E-03 -4.76E-02 -3.01E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.51E-02 -1.16E-01 -5.93E-01
Alopecia ED70 Skin from scalp 3.65E-04 -3.71E-01 -8.84E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.77E-01 6.40E-03 4.13E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 1.31E-01 -1.46E-02 -1.81E-01
Aortic stenosis BB70 Calcified aortic valve 8.89E-01 -1.74E-01 -3.04E-01
Apnea 7A40 Hyperplastic tonsil 5.38E-01 1.10E-01 8.04E-01
Arthropathy FA00-FA5Z Peripheral blood 1.73E-01 7.23E-02 3.01E-01
Asthma CA23 Nasal and bronchial airway 2.34E-02 9.67E-02 2.16E-01
Atopic dermatitis EA80 Skin 6.59E-03 3.52E-02 3.12E-01
Autism 6A02 Whole blood 1.01E-01 -9.65E-02 -4.81E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.59E-02 -2.44E-01 -1.40E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.65E-03 -3.89E-01 -7.66E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.48E-01 -5.83E-03 -2.77E-02
Batten disease 5C56.1 Whole blood 9.17E-01 1.56E-02 9.78E-02
Behcet's disease 4A62 Peripheral blood 5.00E-01 3.23E-02 2.43E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.86E-01 7.13E-03 4.85E-02
Bladder cancer 2C94 Bladder tissue 1.15E-03 3.58E-01 1.62E+00
Breast cancer 2C60-2C6Z Breast tissue 1.21E-15 -1.25E-01 -6.34E-01
Cardioembolic stroke 8B11.20 Whole blood 5.75E-03 4.71E-01 8.23E-01
Cervical cancer 2C77 Cervical tissue 4.35E-01 4.05E-03 1.56E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.58E-01 2.83E-02 4.90E-02
Chronic hepatitis C 1E51.1 Whole blood 9.11E-01 2.40E-02 1.38E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.26E-01 3.17E-02 7.39E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.46E-02 3.86E-02 1.94E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.51E-01 1.46E-03 1.43E-02
Colon cancer 2B90 Colon tissue 8.64E-02 1.60E-02 5.39E-02
Coronary artery disease BA80-BA8Z Peripheral blood 2.10E-01 -1.94E-01 -1.46E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.68E-01 -4.31E-03 -3.73E-02
Endometriosis GA10 Endometrium tissue 4.10E-02 -1.44E-01 -2.39E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.70E-01 -2.74E-02 -2.10E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.19E-02 -1.20E-01 -6.78E-01
Gastric cancer 2B72 Gastric tissue 2.69E-01 -1.86E-01 -2.14E+00
Glioblastopma 2A00.00 Nervous tissue 8.98E-15 1.31E-01 5.39E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.71E-03 -5.20E-01 -1.31E+00
Head and neck cancer 2D42 Head and neck tissue 3.23E-04 -7.53E-02 -3.51E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.50E-01 7.75E-02 3.40E-01
Huntington's disease 8A01.10 Whole blood 8.00E-01 5.72E-02 9.93E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.85E-01 -5.75E-01 -1.64E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.04E-01 5.63E-02 7.96E-01
Influenza 1.00E+30 Whole blood 4.49E-01 5.54E-02 4.67E-01
Interstitial cystitis GC00.3 Bladder tissue 3.43E-02 1.79E-01 1.89E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.44E-01 -1.18E-01 -4.30E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.53E-01 -1.81E-02 -4.42E-02
Ischemic stroke 8B11 Peripheral blood 9.92E-01 3.98E-02 3.17E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.91E-01 3.72E-03 6.60E-03
Lateral sclerosis 8B60.4 Cervical spinal cord 4.53E-01 -1.60E-02 -1.52E-01
Lateral sclerosis 8B60.4 Skin 5.75E-01 1.03E-01 6.16E-01
Liver cancer 2C12.0 Liver tissue 5.30E-05 3.21E-01 8.58E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.85E-03 -4.75E-01 -1.78E+00
Lung cancer 2C25 Lung tissue 6.05E-46 -6.58E-01 -1.59E+00
Lupus erythematosus 4A40 Whole blood 5.53E-07 1.44E-01 3.59E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.15E-02 7.56E-02 2.24E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.42E-01 4.50E-02 3.08E-01
Melanoma 2C30 Skin 3.88E-03 -9.14E-01 -1.15E+00
Multiple myeloma 2A83.1 Bone marrow 6.19E-04 -3.74E-01 -2.35E+00
Multiple myeloma 2A83.1 Peripheral blood 9.26E-02 1.71E-01 1.09E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.17E-01 -1.07E-01 -5.12E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.34E-01 -2.50E-02 -1.60E-01
Myelofibrosis 2A20.2 Whole blood 6.93E-01 -1.45E-01 -1.58E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.46E-04 1.53E-01 5.99E-01
Myopathy 8C70.6 Muscle tissue 4.90E-01 -3.72E-02 -2.03E-01
Neonatal sepsis KA60 Whole blood 3.85E-06 1.60E-01 6.86E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.92E-03 -4.57E-01 -1.41E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.35E-01 1.03E-01 3.42E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.71E-01 8.17E-02 8.09E-01
Olive pollen allergy CA08.00 Peripheral blood 3.44E-01 2.82E-02 2.45E-01
Oral cancer 2B6E Oral tissue 2.91E-06 -2.98E-01 -1.20E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.41E-01 5.98E-02 2.66E-01
Osteoporosis FB83.1 Bone marrow 9.32E-01 1.41E-02 1.03E-01
Ovarian cancer 2C73 Ovarian tissue 3.93E-02 -3.18E-01 -1.50E+00
Pancreatic cancer 2C10 Pancreas 2.11E-01 -1.10E-01 -4.68E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.60E-01 -3.88E-02 -3.95E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.27E-01 -2.81E-02 -3.02E-01
Pituitary cancer 2D12 Pituitary tissue 2.36E-01 -1.30E-01 -3.66E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.57E-01 -5.44E-02 -1.83E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.25E-01 -9.20E-03 -7.29E-02
Polycythemia vera 2A20.4 Whole blood 5.09E-01 2.20E-02 2.11E-01
Pompe disease 5C51.3 Biceps muscle 1.97E-01 6.97E-02 4.36E-01
Preterm birth KA21.4Z Myometrium 2.96E-01 -1.05E-01 -6.00E-01
Prostate cancer 2C82 Prostate 7.19E-02 -8.42E-02 -2.31E-01
Psoriasis EA90 Skin 1.81E-11 2.27E-01 7.84E-01
Rectal cancer 2B92 Rectal colon tissue 7.41E-01 2.53E-02 9.22E-02
Renal cancer 2C90-2C91 Kidney 3.24E-01 9.41E-03 1.88E-02
Retinoblastoma 2D02.2 Uvea 3.59E-01 -1.51E-01 -1.37E+00
Rheumatoid arthritis FA20 Synovial tissue 1.43E-01 1.68E-01 9.33E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.21E-01 -3.77E-02 -2.85E-01
Schizophrenia 6A20 Prefrontal cortex 1.23E-02 7.01E-02 2.77E-01
Schizophrenia 6A20 Superior temporal cortex 9.55E-01 -3.74E-02 -4.05E-01
Scleroderma 4A42.Z Whole blood 7.73E-02 2.57E-01 1.02E+00
Seizure 8A60-8A6Z Whole blood 4.92E-01 2.31E-01 3.96E-01
Sensitive skin EK0Z Skin 3.05E-01 5.81E-02 3.99E-01
Sepsis with septic shock 1G41 Whole blood 7.97E-31 2.80E-01 1.21E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.28E-02 5.84E-01 1.40E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.31E-02 1.81E-01 1.42E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 2.83E-01 -7.81E-02 -1.17E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.08E-01 -2.06E-01 -1.47E+00
Skin cancer 2C30-2C3Z Skin 1.47E-04 -1.46E-01 -3.17E-01
Thrombocythemia 3B63 Whole blood 6.37E-01 -4.46E-02 -4.49E-01
Thrombocytopenia 3B64 Whole blood 9.88E-01 7.06E-02 1.93E-01
Thyroid cancer 2D10 Thyroid 4.00E-01 -5.27E-03 -2.77E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.30E-02 -2.13E-01 -1.17E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.61E-02 2.53E-01 1.21E+00
Type 2 diabetes 5A11 Liver tissue 1.76E-01 -2.93E-01 -1.55E+00
Ureter cancer 2C92 Urothelium 4.75E-01 -3.94E-02 -3.58E-01
Uterine cancer 2C78 Endometrium tissue 5.35E-11 -2.27E-01 -6.68E-01
Vitiligo ED63.0 Skin 5.18E-01 3.98E-02 1.67E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 SLC5A9/SGLT4, a new Na+-dependent glucose transporter, is an essential transporter for mannose, 1,5-anhydro-D-glucitol, and fructose. Life Sci. 2005 Jan 14;76(9):1039-50.