Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT1MPHW)

DTP Name Electroneutral potassium-chloride cotransporter 4 (SLC12A7)
Gene Name SLC12A7
UniProt ID
Q9Y666 (S12A7_HUMAN)
VARIDT ID
DTD0088
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms K-Cl cotransporter 4; KCC4; SLC12A7; Solute carrier family 12 member 7
DTP Family Cation-Chloride Cotransporter (CCC) Family ;
Tissue Specificity Detected in muscle, brain, lung, heart andkidney.
Sequence
MPTNFTVVPVEAHADGGGDETAERTEAPGTPEGPEPERPSPGDGNPRENSPFLNNVEVEQ
ESFFEGKNMALFEEEMDSNPMVSSLLNKLANYTNLSQGVVEHEEDEESRRREAKAPRMGT
FIGVYLPCLQNILGVILFLRLTWIVGVAGVLESFLIVAMCCTCTMLTAISMSAIATNGVV
PAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEIFLTYISPGAAIFQAEAA
GGEAAAMLHNMRVYGTCTLVLMALVVFVGVKYVNKLALVFLACVVLSILAIYAGVIKSAF
DPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSAACDEYFIQNN
VTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAASF
TLLVGIYFPSVTGIMAGSNRSGDLKDAQKSIPTGTILAIVTTSFIYLSCIVLFGACIEGV
VLRDKFGEALQGNLVIGMLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVP
FLQVFGHGKANGEPTWALLLTVLICETGILIASLDSVAPILSMFFLMCYLFVNLACAVQT
LLRTPNWRPRFKFYHWTLSFLGMSLCLALMFICSWYYALSAMLIAGCIYKYIEYRGAEKE
WGDGIRGLSLNAARYALLRVEHGPPHTKNWRPQVLVMLNLDAEQAVKHPRLLSFTSQLKA
GKGLTIVGSVLEGTYLDKHMEAQRAEENIRSLMSTEKTKGFCQLVVSSSLRDGMSHLIQS
AGLGGLKHNTVLMAWPASWKQEDNPFSWKNFVDTVRDTTAAHQALLVAKNVDSFPQNQER
FGGGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQVDDNSIQMKKDLQMFLY
HLRISAEVEVVEMVENDISAFTYERTLMMEQRSQMLKQMQLSKNEQEREAQLIHDRNTAS
HTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNVRRMHTA
VKLNGVVLNKSQDAQLVLLNMPGPPKNRQGDENYMEFLEVLTEGLNRVLLVRGGGREVIT
IYS
Function
This transporter medially conducts neutral potassium chloride co-transport. It is very important for the survival of cochlear outer hair cells and inner hair cells and the maintenance of Corti organs. It may be necessary for lateral chlorine (-) extrusion of kidney basement.
Endogenous Substrate(s) Potassium; Chloride
TCDB ID
2.A.30.1.16
Gene ID
10723
KEGG Pathway
Collecting duct acid secretion (hsa04966 )
Reactome Pathway
Cation-coupled Chloride cotransporters (R-HSA-426117 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cation chloride DMLEJHF N. A. N. A. Investigative [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.19E-01 1.41E-01 2.97E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.02E-01 1.27E-01 5.18E-01
Alopecia ED70 Skin from scalp 1.20E-05 4.11E-01 1.05E+00
Alzheimer's disease 8A20 Entorhinal cortex 5.18E-08 3.02E-01 9.02E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.67E-01 3.01E-01 9.72E-01
Aortic stenosis BB70 Calcified aortic valve 3.98E-01 -3.65E-02 -1.35E-01
Apnea 7A40 Hyperplastic tonsil 1.33E-01 3.20E-01 9.28E-01
Arthropathy FA00-FA5Z Peripheral blood 2.08E-01 1.37E-01 3.11E-01
Asthma CA23 Nasal and bronchial airway 6.80E-01 1.21E-01 2.19E-01
Atopic dermatitis EA80 Skin 8.13E-08 3.84E-01 1.83E+00
Autism 6A02 Whole blood 8.44E-01 1.49E-01 4.06E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.41E-01 6.48E-01 1.67E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.87E-01 7.34E-02 2.13E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.72E-11 3.17E-01 1.17E+00
Batten disease 5C56.1 Whole blood 8.94E-01 8.41E-02 2.36E-01
Behcet's disease 4A62 Peripheral blood 8.59E-01 7.48E-02 1.45E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.86E-01 9.68E-02 3.43E-01
Bladder cancer 2C94 Bladder tissue 6.44E-01 7.27E-03 4.15E-02
Breast cancer 2C60-2C6Z Breast tissue 2.94E-85 4.92E-01 1.77E+00
Cardioembolic stroke 8B11.20 Whole blood 2.16E-01 3.67E-01 6.04E-01
Cervical cancer 2C77 Cervical tissue 4.05E-01 1.51E-01 3.81E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.93E-01 1.46E-01 1.64E-01
Chronic hepatitis C 1E51.1 Whole blood 2.62E-02 3.59E-01 8.89E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.77E-01 -3.80E-02 -1.41E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.80E-04 2.02E-01 6.83E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.39E-02 -2.78E-01 -8.10E-01
Colon cancer 2B90 Colon tissue 4.38E-08 1.18E-01 4.37E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.89E-01 -2.97E-02 -5.97E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.49E-01 -3.30E-01 -4.96E-01
Endometriosis GA10 Endometrium tissue 6.56E-01 1.57E-02 2.82E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.74E-01 2.01E-01 7.83E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.57E-04 8.58E-01 2.45E+00
Gastric cancer 2B72 Gastric tissue 3.15E-01 1.59E-01 3.41E-01
Glioblastopma 2A00.00 Nervous tissue 2.06E-43 4.09E-01 8.98E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.97E-02 4.56E-01 6.20E-01
Head and neck cancer 2D42 Head and neck tissue 3.24E-04 -4.43E-02 -4.83E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.66E-01 1.58E-01 5.08E-01
Huntington's disease 8A01.10 Whole blood 3.13E-01 1.75E-01 3.17E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.51E-01 4.44E-01 1.20E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.55E-02 1.87E-01 5.00E-01
Influenza 1.00E+30 Whole blood 4.86E-01 -3.96E-01 -7.61E-01
Interstitial cystitis GC00.3 Bladder tissue 1.84E-02 5.59E-01 2.57E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.55E-04 8.69E-01 2.70E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.30E-01 -1.03E-01 -2.48E-01
Ischemic stroke 8B11 Peripheral blood 9.29E-01 -5.06E-02 -1.54E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.66E-04 -3.08E-01 -4.90E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.47E-01 -1.01E-01 -9.29E-02
Lateral sclerosis 8B60.4 Skin 2.52E-01 -6.99E-02 -2.27E-01
Liver cancer 2C12.0 Liver tissue 8.43E-09 4.45E-01 1.18E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.38E-03 3.03E-01 1.28E+00
Lung cancer 2C25 Lung tissue 5.87E-68 5.04E-01 1.87E+00
Lupus erythematosus 4A40 Whole blood 3.22E-01 -8.69E-03 -1.49E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.91E-01 -3.37E-01 -5.28E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.22E-01 -2.99E-02 -1.16E-01
Melanoma 2C30 Skin 5.63E-03 -4.27E-01 -5.77E-01
Multiple myeloma 2A83.1 Bone marrow 1.38E-03 -9.70E-01 -1.83E+00
Multiple myeloma 2A83.1 Peripheral blood 8.40E-01 -5.63E-02 -9.05E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.03E-01 -2.92E-01 -7.69E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.44E-02 1.15E-01 3.79E-01
Myelofibrosis 2A20.2 Whole blood 2.51E-02 -1.86E-01 -8.53E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.88E-01 -4.11E-02 -3.94E-02
Myopathy 8C70.6 Muscle tissue 7.68E-05 6.84E-01 4.18E+00
Neonatal sepsis KA60 Whole blood 1.51E-14 -5.21E-01 -1.29E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.45E-06 6.41E-01 2.04E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.04E-01 9.49E-02 3.46E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.84E-01 2.68E-02 1.27E-01
Olive pollen allergy CA08.00 Peripheral blood 9.28E-01 1.14E-01 4.16E-01
Oral cancer 2B6E Oral tissue 3.64E-05 2.72E-01 7.17E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.49E-01 4.98E-01 1.01E+00
Osteoporosis FB83.1 Bone marrow 3.25E-01 -1.34E-01 -1.06E+00
Ovarian cancer 2C73 Ovarian tissue 1.60E-03 9.44E-01 1.72E+00
Pancreatic cancer 2C10 Pancreas 5.20E-02 1.42E-01 3.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.67E-01 2.36E-01 7.74E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.18E-01 -1.86E-01 -6.88E-01
Pituitary cancer 2D12 Pituitary tissue 1.38E-06 -7.95E-01 -1.99E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.17E-06 -8.96E-01 -2.49E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.99E-01 4.17E-02 2.50E-01
Polycythemia vera 2A20.4 Whole blood 6.84E-02 3.76E-02 1.43E-01
Pompe disease 5C51.3 Biceps muscle 3.67E-03 8.34E-01 3.12E+00
Preterm birth KA21.4Z Myometrium 5.54E-01 -1.83E-02 -5.27E-02
Prostate cancer 2C82 Prostate 9.32E-02 -1.76E-01 -4.88E-01
Psoriasis EA90 Skin 6.89E-12 -2.75E-01 -8.96E-01
Rectal cancer 2B92 Rectal colon tissue 1.06E-04 3.64E-01 2.85E+00
Renal cancer 2C90-2C91 Kidney 3.48E-02 3.37E-01 9.00E-01
Retinoblastoma 2D02.2 Uvea 1.75E-01 1.23E-01 5.08E-01
Rheumatoid arthritis FA20 Synovial tissue 2.37E-01 1.06E-01 2.49E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.63E-01 -1.57E-02 -8.91E-02
Schizophrenia 6A20 Prefrontal cortex 1.99E-02 3.62E-01 4.47E-01
Schizophrenia 6A20 Superior temporal cortex 3.98E-01 1.06E-03 4.93E-03
Scleroderma 4A42.Z Whole blood 6.43E-01 -1.52E-01 -3.15E-01
Seizure 8A60-8A6Z Whole blood 2.94E-01 -4.37E-02 -2.07E-01
Sensitive skin EK0Z Skin 2.32E-01 -3.10E-01 -1.56E+00
Sepsis with septic shock 1G41 Whole blood 1.59E-51 -7.23E-01 -1.89E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.07E-01 2.06E-02 7.27E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.84E-02 -2.72E-01 -1.08E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.18E-01 7.66E-02 7.94E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.44E-01 4.45E-01 9.76E-01
Skin cancer 2C30-2C3Z Skin 4.00E-16 -2.50E-01 -6.98E-01
Thrombocythemia 3B63 Whole blood 4.33E-01 7.92E-02 3.46E-01
Thrombocytopenia 3B64 Whole blood 4.03E-01 3.73E-01 3.23E-01
Thyroid cancer 2D10 Thyroid 5.37E-04 1.09E-01 3.93E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.12E-10 9.16E-01 3.96E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.66E-01 3.09E-01 1.29E+00
Type 2 diabetes 5A11 Liver tissue 2.03E-01 -1.78E-01 -8.06E-01
Ureter cancer 2C92 Urothelium 2.47E-02 3.15E-01 1.01E+00
Uterine cancer 2C78 Endometrium tissue 3.14E-01 8.29E-03 1.38E-02
Vitiligo ED63.0 Skin 4.04E-01 -1.38E-01 -3.93E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 12 member 7 (SLC12A7) DTT Info
DTP DTT Type Literature-reported
1 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
DIOA DMBKJL8 Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 974).
2 A molecular analysis of the Na(+)-independent cation chloride cotransporters. Cell Physiol Biochem. 2013;32(7):14-31.