Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT2CAPQ)

DTP Name Sodium/myo-inositol cotransporter 2 (SLC5A11)
Gene Name SLC5A11
UniProt ID
Q8WWX8 (SC5AB_HUMAN)
VARIDT ID
DTD0420
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
KST1; Na(+)/myo-inositol cotransporter 2; RKST1; SGLT6; SLC5A11; SLGTX; SMIT2; Sodium-dependent glucose cotransporter; Sodium/glucose cotransporter KST1; Sodium/myo-inositol transporter 2; Solute carrier family 5 member 11
DTP Family Solute:Sodium Symporter (SSS) Family ;
Sequence
MESGTSSPQPPQLDPLDAFPQKGLEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFL
AGGDMVWWPVGASLFASNVGSGHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIY
IAGQVTTMPEYLRKRFGGIRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLA
IVGLLAITAVYTVAGGLAAVIYTDALQTLIMLIGALTLMGYSFAAVGGMEGLKEKYFLAL
ASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVLFGMSIPSLWYWCTDQVIVQRTLAAK
NLSHAKGGALMAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKICSNPSGCSDIA
YPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIV
GRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGA
FWGLISGLLLGLVRLVLDFIYVQPRCDQPDERPVLVKSIHYLYFSMILSTVTLITVSTVS
WFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQE
NTSKTHSCDMTPKQSKVVKAILWLCGIQEKGKEELPARAEAIIVSLEENPLVKTLLDVNL
IFCVSCAIFIWGYFA
Function
This transporter involved in the sodium-dependent cotransport of myo-inositol (MI) with a Na(+):MI stoichiometry of 2:1. Exclusively responsible for apical MI transport and absorption in intestine. Also can transport D-chiro-inositol (DCI) but not L-fructose. Exhibits stereospecific cotransport of both D-glucose and D-xylose. May play a role in the regulation of MI concentration in serum, involving reabsorption in at least the proximal tubule of the kidney.
Endogenous Substrate(s) Na+
TCDB ID
2.A.21.3.6
Gene ID
115584
Reactome Pathway
Inositol transporters (R-HSA-429593 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Clinical Trial Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Myo-inositol DMQKSGI Alzheimer disease 8A20 Phase 2 [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.59E-01 6.82E-02 2.05E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.42E-01 -5.85E-02 -1.73E-01
Alopecia ED70 Skin from scalp 2.90E-01 -5.16E-02 -1.62E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.11E-04 2.65E-01 3.07E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.04E-01 -3.81E-02 -3.18E-01
Aortic stenosis BB70 Calcified aortic valve 9.30E-01 -5.42E-02 -6.29E-02
Apnea 7A40 Hyperplastic tonsil 8.27E-01 -6.85E-03 -2.78E-02
Arthropathy FA00-FA5Z Peripheral blood 4.23E-01 -1.28E-01 -6.47E-01
Asthma CA23 Nasal and bronchial airway 2.61E-02 -1.29E-01 -2.88E-01
Atopic dermatitis EA80 Skin 6.81E-01 2.98E-02 1.64E-01
Autism 6A02 Whole blood 3.40E-01 2.72E-02 1.02E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.41E-03 -2.98E-01 -1.50E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.05E-01 7.21E-02 4.28E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.99E-04 2.14E-01 6.14E-01
Batten disease 5C56.1 Whole blood 5.68E-01 8.34E-02 3.68E-01
Behcet's disease 4A62 Peripheral blood 4.81E-01 2.14E-04 1.01E-03
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.83E-01 2.53E-01 3.82E-01
Bladder cancer 2C94 Bladder tissue 3.31E-03 6.34E-01 1.62E+00
Breast cancer 2C60-2C6Z Breast tissue 1.31E-03 1.36E-01 2.67E-01
Cardioembolic stroke 8B11.20 Whole blood 1.54E-01 -1.69E-01 -3.11E-01
Cervical cancer 2C77 Cervical tissue 1.45E-01 8.90E-02 3.15E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.38E-01 1.23E-01 3.83E-01
Chronic hepatitis C 1E51.1 Whole blood 9.53E-01 -2.06E-02 -1.08E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.06E-01 4.27E-02 1.79E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.07E-04 2.65E-01 8.73E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.73E-01 6.64E-02 4.09E-01
Colon cancer 2B90 Colon tissue 1.55E-20 -3.93E-01 -8.10E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.81E-01 -3.48E-01 -1.03E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.55E-01 1.18E-01 9.78E-01
Endometriosis GA10 Endometrium tissue 6.72E-01 3.19E-02 1.16E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.82E-01 1.65E-01 8.30E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.13E-02 -1.98E-01 -5.52E-01
Gastric cancer 2B72 Gastric tissue 6.55E-01 3.98E-02 1.16E-01
Glioblastopma 2A00.00 Nervous tissue 1.42E-82 -1.55E+00 -1.37E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.08E-02 -8.26E-01 -1.20E+00
Head and neck cancer 2D42 Head and neck tissue 5.73E-01 1.72E-02 7.28E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.99E-01 2.38E-01 2.06E-01
Huntington's disease 8A01.10 Whole blood 6.98E-01 1.13E-01 6.35E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.35E-01 2.86E-02 2.40E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.67E-01 2.51E-02 1.27E-01
Influenza 1.00E+30 Whole blood 1.42E-01 3.77E-01 1.26E+00
Interstitial cystitis GC00.3 Bladder tissue 8.87E-02 1.37E-01 1.10E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.58E-01 1.25E-01 3.45E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.63E-03 -2.55E-01 -5.51E-01
Ischemic stroke 8B11 Peripheral blood 2.69E-02 1.34E-01 8.22E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.90E-01 3.18E-02 8.42E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 8.88E-01 -5.29E-02 -1.44E-01
Lateral sclerosis 8B60.4 Skin 9.83E-01 9.05E-02 3.21E-01
Liver cancer 2C12.0 Liver tissue 4.95E-02 -2.83E-02 -8.79E-02
Liver failure DB99.7-DB99.8 Liver tissue 6.25E-02 4.62E-01 1.07E+00
Lung cancer 2C25 Lung tissue 7.07E-01 -2.33E-02 -8.27E-02
Lupus erythematosus 4A40 Whole blood 2.12E-02 -9.50E-02 -1.98E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.55E-01 3.19E-02 1.05E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.62E-01 1.33E-02 2.00E-02
Melanoma 2C30 Skin 6.78E-02 -1.27E-01 -2.92E-01
Multiple myeloma 2A83.1 Bone marrow 1.09E-03 -4.77E-01 -2.01E+00
Multiple myeloma 2A83.1 Peripheral blood 9.22E-02 -2.12E-01 -1.03E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.04E-01 2.90E-01 8.65E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.13E-01 -3.83E-02 -2.45E-01
Myelofibrosis 2A20.2 Whole blood 1.54E-11 2.37E-01 2.11E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.77E-01 1.08E-01 2.36E-01
Myopathy 8C70.6 Muscle tissue 1.58E-01 -2.01E-01 -5.56E-01
Neonatal sepsis KA60 Whole blood 1.87E-02 -9.70E-02 -2.58E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.75E-09 -3.35E+00 -6.28E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.17E-01 9.61E-02 4.30E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.44E-02 2.82E-01 1.82E+00
Olive pollen allergy CA08.00 Peripheral blood 6.61E-02 5.11E-01 1.41E+00
Oral cancer 2B6E Oral tissue 8.40E-10 -6.17E-01 -1.84E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.51E-02 -3.61E-01 -6.59E-01
Osteoporosis FB83.1 Bone marrow 2.66E-01 3.17E-02 2.41E-01
Ovarian cancer 2C73 Ovarian tissue 5.86E-01 -1.38E-01 -2.71E-01
Pancreatic cancer 2C10 Pancreas 4.01E-05 -6.60E-01 -1.51E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.04E-02 3.37E-01 4.55E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.37E-01 -1.41E-01 -7.51E-01
Pituitary cancer 2D12 Pituitary tissue 6.23E-01 3.27E-02 1.30E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.53E-01 0.00E+00 0.00E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.66E-01 -1.01E-02 -5.06E-02
Polycythemia vera 2A20.4 Whole blood 6.85E-10 2.42E-01 1.66E+00
Pompe disease 5C51.3 Biceps muscle 7.05E-02 -1.14E-01 -5.34E-01
Preterm birth KA21.4Z Myometrium 2.50E-01 -1.43E-01 -6.50E-01
Prostate cancer 2C82 Prostate 1.14E-01 7.98E-02 1.66E-01
Psoriasis EA90 Skin 3.87E-04 -1.61E-01 -4.64E-01
Rectal cancer 2B92 Rectal colon tissue 1.80E-02 -5.76E-01 -1.42E+00
Renal cancer 2C90-2C91 Kidney 1.22E-03 -1.04E+00 -1.36E+00
Retinoblastoma 2D02.2 Uvea 4.85E-01 -2.77E-02 -1.92E-01
Rheumatoid arthritis FA20 Synovial tissue 5.73E-02 -4.14E-01 -8.63E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.52E-01 4.19E-04 3.43E-03
Schizophrenia 6A20 Prefrontal cortex 2.71E-01 -1.23E-01 -1.89E-01
Schizophrenia 6A20 Superior temporal cortex 2.97E-02 -3.10E-01 -7.15E-01
Scleroderma 4A42.Z Whole blood 5.64E-01 -5.34E-02 -4.11E-01
Seizure 8A60-8A6Z Whole blood 9.97E-01 3.66E-02 1.31E-01
Sensitive skin EK0Z Skin 2.03E-01 2.40E-01 1.33E+00
Sepsis with septic shock 1G41 Whole blood 2.24E-03 -1.69E-01 -4.56E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.01E-01 1.96E-02 6.51E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.49E-02 1.14E-01 4.36E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.46E-02 2.61E-01 2.13E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.88E-01 -1.33E-01 -4.72E-01
Skin cancer 2C30-2C3Z Skin 3.52E-01 -4.06E-02 -1.01E-01
Thrombocythemia 3B63 Whole blood 2.85E-03 2.25E-01 1.77E+00
Thrombocytopenia 3B64 Whole blood 4.44E-01 -6.31E-02 -1.40E-01
Thyroid cancer 2D10 Thyroid 1.04E-01 7.76E-03 2.76E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.06E-05 -5.37E-01 -2.61E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.35E-01 -8.37E-01 -2.06E+00
Type 2 diabetes 5A11 Liver tissue 9.47E-01 -1.77E-01 -5.74E-01
Ureter cancer 2C92 Urothelium 6.43E-01 1.41E-02 5.90E-02
Uterine cancer 2C78 Endometrium tissue 4.66E-01 8.84E-02 2.30E-01
Vitiligo ED63.0 Skin 1.06E-02 -1.23E-01 -8.92E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The sodium/glucose cotransport family SLC5. Pflugers Arch. 2004 Feb;447(5):510-8.