Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT2IMBW)

DTP Name ABC transporter 7 protein (ABCB7)
Gene Name ABCB7
UniProt ID
O75027 (ABCB7_HUMAN)
VARIDT ID
DTD0053
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ATP-binding cassette sub-family B member 7, mitochondrial; ABC7; ABCB7; ASAT; ATP-binding cassette transporter 7; Atm1p; EST140535
DTP Family ATP-Binding Cassette (ABC) Superfamily ;
Sequence
MALLAMHSWRWAAAAAAFEKRRHSAILIRPLVSVSGSGPQWRPHQLGALGTARAYQIPES
LKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKI
IKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSD
APNTVATMATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGF
HLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGT
LGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFL
KTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVLASQGIVAGTLTVGDLVMVNGLLFQL
SLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNVHFE
YIEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVS
LESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDT
QVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTS
IFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKW
EAKKENISKEEERKKLQEEIVNSVKGCGNCSC
Function This transporter mediates the transport of heme from the mitochondria to the cytosol.
Endogenous Substrate(s) Fe2+; FeS-glutathione; FeS-proteoliposome
TCDB ID
3.A.1.210.4
Gene ID
22
KEGG Pathway
ABC transporters (hsa02010 )
Reactome Pathway
Cytosolic iron-sulfur cluster assembly (R-HSA-2564830 )
Mitochondrial ABC transporters (R-HSA-1369007 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.01E-03 1.42E-01 3.92E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.16E-01 -2.84E-02 -9.54E-02
Alopecia ED70 Skin from scalp 2.45E-01 5.24E-02 3.13E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.43E-12 2.21E-01 7.95E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.95E-01 5.65E-02 2.25E-01
Aortic stenosis BB70 Calcified aortic valve 7.37E-01 -2.21E-01 -2.38E-01
Apnea 7A40 Hyperplastic tonsil 5.55E-01 3.08E-01 5.31E-01
Arthropathy FA00-FA5Z Peripheral blood 4.36E-01 -1.92E-02 -9.86E-02
Asthma CA23 Nasal and bronchial airway 1.38E-02 2.38E-01 4.79E-01
Atopic dermatitis EA80 Skin 1.02E-04 -1.98E-01 -1.17E+00
Autism 6A02 Whole blood 1.48E-01 1.21E-01 3.13E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.10E-01 -3.23E-02 -1.53E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.78E-02 3.70E-01 1.21E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.05E-04 -1.81E-01 -5.41E-01
Batten disease 5C56.1 Whole blood 2.11E-01 8.45E-02 8.32E-01
Behcet's disease 4A62 Peripheral blood 3.68E-01 1.19E-02 7.07E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.27E-02 8.39E-02 4.78E-01
Bladder cancer 2C94 Bladder tissue 2.06E-05 -6.29E-01 -3.49E+00
Breast cancer 2C60-2C6Z Breast tissue 7.29E-02 -8.26E-02 -2.01E-01
Cardioembolic stroke 8B11.20 Whole blood 4.24E-01 -8.87E-02 -5.48E-01
Cervical cancer 2C77 Cervical tissue 5.40E-01 -1.22E-02 -2.36E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.89E-01 1.54E-01 1.38E-01
Chronic hepatitis C 1E51.1 Whole blood 9.65E-01 -5.55E-02 -2.83E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.37E-01 -4.62E-02 -1.61E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.53E-06 -2.41E-01 -8.35E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.19E-01 1.22E-01 5.81E-01
Colon cancer 2B90 Colon tissue 3.45E-10 1.32E-01 4.74E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.34E-01 4.95E-01 1.14E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.69E-01 4.84E-02 1.47E-01
Endometriosis GA10 Endometrium tissue 7.61E-01 5.70E-02 9.23E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.01E-01 8.03E-03 5.23E-02
Familial hypercholesterolemia 5C80.00 Whole blood 2.97E-16 1.23E+00 1.94E+00
Gastric cancer 2B72 Gastric tissue 1.40E-01 6.58E-01 1.14E+00
Glioblastopma 2A00.00 Nervous tissue 3.48E-169 1.01E+00 2.28E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.89E-04 9.25E-01 1.85E+00
Head and neck cancer 2D42 Head and neck tissue 2.66E-05 -1.65E-01 -6.15E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.68E-02 1.99E-01 5.07E-01
Huntington's disease 8A01.10 Whole blood 1.78E-03 -1.14E-01 -1.92E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.56E-01 -2.95E-02 -1.94E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.04E-01 4.45E-02 3.36E-01
Influenza 1.00E+30 Whole blood 7.92E-05 -9.76E-01 -8.51E+00
Interstitial cystitis GC00.3 Bladder tissue 5.29E-02 -9.72E-02 -7.90E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.15E-01 -1.40E-01 -3.57E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.12E-02 -2.97E-02 -2.41E-01
Ischemic stroke 8B11 Peripheral blood 9.45E-02 -6.07E-02 -3.11E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.21E-02 3.03E-02 7.29E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.04E-01 -1.15E-02 -3.35E-02
Lateral sclerosis 8B60.4 Skin 2.87E-01 1.41E-02 1.81E-01
Liver cancer 2C12.0 Liver tissue 5.49E-02 -1.81E-01 -5.99E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.80E-01 8.22E-02 3.98E-01
Lung cancer 2C25 Lung tissue 2.32E-32 3.49E-01 1.28E+00
Lupus erythematosus 4A40 Whole blood 8.19E-01 7.63E-02 1.38E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.69E-01 2.50E-02 1.43E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.12E-01 8.19E-02 4.83E-01
Melanoma 2C30 Skin 5.67E-02 -9.68E-02 -1.27E-01
Multiple myeloma 2A83.1 Bone marrow 6.16E-05 5.82E-01 2.34E+00
Multiple myeloma 2A83.1 Peripheral blood 4.52E-01 -8.40E-02 -5.25E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.25E-01 -5.84E-03 -2.94E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.03E-05 -3.37E-01 -8.85E-01
Myelofibrosis 2A20.2 Whole blood 9.88E-01 6.98E-02 4.45E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.52E-02 -1.94E-01 -3.38E-01
Myopathy 8C70.6 Muscle tissue 3.07E-02 -1.42E-01 -7.17E-01
Neonatal sepsis KA60 Whole blood 2.92E-04 -3.12E-01 -8.21E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.95E-10 2.07E+00 5.94E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.53E-01 9.57E-02 3.72E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.84E-01 -6.31E-02 -2.82E-01
Olive pollen allergy CA08.00 Peripheral blood 4.30E-01 -3.54E-01 -5.30E-01
Oral cancer 2B6E Oral tissue 1.45E-02 3.60E-01 6.47E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.85E-01 -5.25E-01 -5.88E-01
Osteoporosis FB83.1 Bone marrow 9.05E-01 -2.56E-02 -1.86E-01
Ovarian cancer 2C73 Ovarian tissue 5.90E-02 3.60E-01 1.06E+00
Pancreatic cancer 2C10 Pancreas 7.06E-01 5.21E-02 1.07E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.00E-01 -1.60E-02 -8.01E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.93E-02 -8.91E-02 -6.62E-01
Pituitary cancer 2D12 Pituitary tissue 9.26E-02 1.11E-01 3.16E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.30E-03 3.14E-01 1.87E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.72E-01 -2.99E-02 -1.20E-01
Polycythemia vera 2A20.4 Whole blood 3.34E-05 -2.31E-01 -1.36E+00
Pompe disease 5C51.3 Biceps muscle 4.42E-01 -4.05E-02 -1.63E-01
Preterm birth KA21.4Z Myometrium 5.53E-01 1.03E-01 7.61E-01
Prostate cancer 2C82 Prostate 1.11E-03 3.93E-01 6.00E-01
Psoriasis EA90 Skin 1.84E-01 2.64E-02 1.04E-01
Rectal cancer 2B92 Rectal colon tissue 3.96E-01 -1.49E-01 -6.97E-01
Renal cancer 2C90-2C91 Kidney 2.40E-04 7.11E-01 1.67E+00
Retinoblastoma 2D02.2 Uvea 2.21E-05 8.57E-01 7.02E+00
Rheumatoid arthritis FA20 Synovial tissue 1.40E-01 -6.85E-01 -8.06E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.86E-01 -2.63E-02 -1.63E-01
Schizophrenia 6A20 Prefrontal cortex 1.35E-01 1.55E-01 1.64E-01
Schizophrenia 6A20 Superior temporal cortex 8.97E-01 -8.80E-03 -4.15E-02
Scleroderma 4A42.Z Whole blood 4.42E-05 3.77E-01 2.42E+00
Seizure 8A60-8A6Z Whole blood 7.31E-01 7.14E-02 1.90E-01
Sensitive skin EK0Z Skin 3.66E-01 -3.50E-02 -3.47E-01
Sepsis with septic shock 1G41 Whole blood 1.76E-35 -5.44E-01 -1.55E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.99E-01 -4.49E-01 -9.08E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.22E-03 -6.59E-01 -1.06E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 6.68E-01 1.81E-01 4.39E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.26E-01 -1.28E-01 -6.04E-01
Skin cancer 2C30-2C3Z Skin 7.97E-08 -1.57E-01 -5.13E-01
Thrombocythemia 3B63 Whole blood 2.80E-01 -1.85E-01 -1.15E+00
Thrombocytopenia 3B64 Whole blood 3.43E-01 -1.14E+00 -1.05E+00
Thyroid cancer 2D10 Thyroid 1.30E-07 1.73E-01 5.42E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.71E-05 -4.86E-01 -1.84E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.08E-01 3.36E-01 5.19E+00
Type 2 diabetes 5A11 Liver tissue 4.84E-01 -8.23E-02 -6.32E-01
Ureter cancer 2C92 Urothelium 7.00E-01 -8.76E-02 -3.21E-01
Uterine cancer 2C78 Endometrium tissue 2.40E-09 2.57E-01 4.98E-01
Vitiligo ED63.0 Skin 2.60E-01 -7.39E-03 -6.46E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases