Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT2LGOY)

DTP Name Putative sodium-coupled neutral amino acid transporter 10 (SLC38A10)
Gene Name SLC38A10
UniProt ID
Q9HBR0 (S38AA_HUMAN)
VARIDT ID
DTD0327
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms PP1744; SLC38A10; Solute carrier family 38 member 10
DTP Family Amino Acid/Auxin Permease (AAAP) Family ;
Sequence
MTAAAASNWGLITNIVNSIVGVSVLTMPFCFKQCGIVLGALLLVFCSWMTHQSCMFLVKS
ASLSKRRTYAGLAFHAYGKAGKMLVETSMIGLMLGTCIAFYVVIGDLGSNFFARLFGFQV
GGTFRMFLLFAVSLCIVLPLSLQRNMMASIQSFSAMALLFYTVFMFVIVLSSLKHGLFSG
QWLRRVSYVRWEGVFRCIPIFGMSFACQSQVLPTYDSLDEPSVKTMSSIFASSLNVVTTF
YVMVGFFGYVSFTEATAGNVLMHFPSNLVTEMLRVGFMMSVAVGFPMMILPCRQALSTLL
CEQQQKDGTFAAGGYMPPLRFKALTLSVVFGTMVGGILIPNVETILGLTGATMGSLICFI
CPALIYKKIHKNALSSQVVLWVGLGVLVVSTVTTLSVSEEVPEDLAEEAPGGRLGEAEGL
MKVEAARLSAQDPVVAVAEDGREKPKLPKEREELEQAQIKGPVDVPGREDGKEAPEEAQL
DRPGQGIAVPVGEAHRHEPPVPHDKVVVDEGQDREVPEENKPPSRHAGGKAPGVQGQMAP
PLPDSEREKQEPEQGEVGKRPGQAQALEEAGDLPEDPQKVPEADGQPAVQPAKEDLGPGD
RGLHPRPQAVLSEQQNGLAVGGGEKAKGGPPPGNAAGDTGQPAEDSDHGGKPPLPAEKPA
PGPGLPPEPREQRDVERAGGNQAASQLEEAGRAEMLDHAVLLQVIKEQQVQQKRLLDQQE
KLLAVIEEQHKEIHQQRQEDEEDKPRQVEVHQEPGAAVPRGQEAPEGKARETVENLPPLP
LDPVLRAPGGRPAPSQDLNQRSLEHSEGPVGRDPAGPPDGGPDTEPRAAQAKLRDGQKDA
APRAAGTVKELPKGPEQVPVPDPAREAGGPEERLAEEFPGQSQDVTGGSQDRKKPGKEVA
ATGTSILKEANWLVAGPGAETGDPRMKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPE
LRVISDGEQGGQQGHRLDHGGHLEMRKARGGDHVPVSHEQPRGGEDAAVQEPRQRPEPEL
GLKRAVPGGQRPDNAKPNRDLKLQAGSDLRRRRRDLGPHAEGQLAPRDGVIIGLNPLPDV
QVNDLRGALDAQLRQAAGGALQVVHSRQLRQAPGPPEES
Function This transporter is putative sodium-dependent amino acid/proton antiporter.
Endogenous Substrate(s) Amino acids; Proton
TCDB ID
2.A.18.6.16
Gene ID
124565

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Glutamic Acid DM4PUDW Schizophrenia 6A20 Approved [1]
------------------------------------------------------------------------------------
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Aspartic acid DMK7EYA N. A. N. A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.07E-06 1.54E-01 5.32E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.95E-01 -1.87E-03 -5.35E-03
Alopecia ED70 Skin from scalp 3.50E-02 -1.46E-01 -5.90E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.99E-01 2.09E-02 1.41E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.92E-01 7.07E-02 2.45E-01
Aortic stenosis BB70 Calcified aortic valve 7.53E-01 1.83E-01 3.74E-01
Apnea 7A40 Hyperplastic tonsil 4.30E-01 3.11E-02 1.12E-01
Arthropathy FA00-FA5Z Peripheral blood 8.74E-01 1.31E-02 9.04E-02
Asthma CA23 Nasal and bronchial airway 8.84E-01 -6.09E-03 -2.34E-02
Atopic dermatitis EA80 Skin 1.34E-02 -1.42E-01 -7.61E-01
Autism 6A02 Whole blood 7.37E-01 -1.88E-02 -8.92E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.60E-04 -2.99E-01 -1.62E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.61E-01 -1.22E-01 -4.97E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.60E-07 2.02E-01 7.03E-01
Batten disease 5C56.1 Whole blood 2.45E-02 -3.50E-01 -2.25E+00
Behcet's disease 4A62 Peripheral blood 6.00E-01 -3.39E-02 -1.42E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.10E-01 1.48E-02 9.11E-02
Bladder cancer 2C94 Bladder tissue 5.17E-01 1.22E-01 7.67E-01
Breast cancer 2C60-2C6Z Breast tissue 1.36E-23 2.52E-01 7.18E-01
Cardioembolic stroke 8B11.20 Whole blood 2.24E-01 2.48E-02 1.57E-01
Cervical cancer 2C77 Cervical tissue 8.11E-02 1.42E-02 6.25E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.87E-01 -5.19E-03 -2.13E-02
Chronic hepatitis C 1E51.1 Whole blood 9.79E-01 -1.47E-02 -1.06E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.46E-01 -7.21E-02 -3.45E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.77E-03 1.57E-01 6.82E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.99E-01 -8.91E-03 -7.37E-02
Colon cancer 2B90 Colon tissue 5.85E-04 -8.76E-02 -3.04E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.18E-01 -8.83E-02 -4.83E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.49E-01 -1.70E-01 -4.22E-01
Endometriosis GA10 Endometrium tissue 9.33E-01 6.86E-02 2.87E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.95E-01 8.10E-02 3.06E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.97E-01 1.58E-03 8.58E-03
Gastric cancer 2B72 Gastric tissue 3.04E-01 -2.38E-01 -1.41E+00
Glioblastopma 2A00.00 Nervous tissue 3.42E-31 -2.07E-01 -8.52E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.35E-02 -1.70E-01 -1.00E+00
Head and neck cancer 2D42 Head and neck tissue 5.65E-03 1.17E-01 4.14E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.96E-01 2.10E-02 1.24E-01
Huntington's disease 8A01.10 Whole blood 4.93E-01 6.43E-02 6.63E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.79E-03 2.90E-01 2.24E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.74E-01 9.77E-02 7.69E-01
Influenza 1.00E+30 Whole blood 5.43E-01 -3.38E-02 -8.80E-02
Interstitial cystitis GC00.3 Bladder tissue 4.99E-02 3.66E-01 1.56E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.19E-01 5.61E-02 2.66E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.10E-01 -4.17E-02 -2.24E-01
Ischemic stroke 8B11 Peripheral blood 5.65E-01 -3.59E-03 -1.37E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 7.59E-03 -1.19E-01 -4.23E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.14E-01 5.80E-02 4.28E-01
Lateral sclerosis 8B60.4 Skin 8.26E-01 -8.86E-02 -2.20E-01
Liver cancer 2C12.0 Liver tissue 9.49E-01 -1.04E-01 -2.58E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.54E-04 1.20E+00 3.78E+00
Lung cancer 2C25 Lung tissue 7.75E-02 -8.48E-02 -3.04E-01
Lupus erythematosus 4A40 Whole blood 3.50E-03 1.41E-01 5.24E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.96E-01 -5.30E-03 -2.57E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.91E-01 -3.75E-02 -2.41E-01
Melanoma 2C30 Skin 3.08E-01 2.56E-01 5.10E-01
Multiple myeloma 2A83.1 Bone marrow 1.64E-01 -1.76E-01 -8.67E-01
Multiple myeloma 2A83.1 Peripheral blood 9.89E-01 7.95E-02 5.38E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.74E-01 9.92E-02 5.84E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.67E-04 8.48E-02 6.19E-01
Myelofibrosis 2A20.2 Whole blood 3.46E-01 5.47E-02 3.64E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.72E-02 -1.22E-01 -2.80E-01
Myopathy 8C70.6 Muscle tissue 3.51E-01 -6.77E-02 -3.97E-01
Neonatal sepsis KA60 Whole blood 3.14E-09 2.60E-01 9.21E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.99E-04 -3.44E-01 -1.37E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.75E-01 -1.50E-01 -6.16E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.79E-01 2.28E-02 1.70E-01
Olive pollen allergy CA08.00 Peripheral blood 9.89E-01 1.08E-01 4.17E-01
Oral cancer 2B6E Oral tissue 7.08E-07 -3.60E-01 -8.72E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.79E-02 -2.58E-01 -1.07E+00
Osteoporosis FB83.1 Bone marrow 7.27E-02 2.08E-01 1.03E+00
Ovarian cancer 2C73 Ovarian tissue 5.73E-02 -2.00E-01 -6.39E-01
Pancreatic cancer 2C10 Pancreas 6.50E-02 -2.33E-01 -3.94E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.93E-01 8.66E-02 3.71E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.60E-01 -4.02E-02 -2.04E-01
Pituitary cancer 2D12 Pituitary tissue 2.09E-04 -4.58E-01 -1.81E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.16E-02 -2.20E-01 -8.58E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.63E-01 -7.00E-02 -2.76E-01
Polycythemia vera 2A20.4 Whole blood 4.24E-01 -2.86E-02 -1.84E-01
Pompe disease 5C51.3 Biceps muscle 8.65E-01 -7.94E-02 -5.17E-01
Preterm birth KA21.4Z Myometrium 8.76E-01 -1.67E-03 -1.16E-02
Prostate cancer 2C82 Prostate 2.59E-01 1.26E-01 4.19E-01
Psoriasis EA90 Skin 1.22E-05 1.88E-01 6.50E-01
Rectal cancer 2B92 Rectal colon tissue 6.92E-01 -7.49E-03 -1.96E-02
Renal cancer 2C90-2C91 Kidney 1.30E-02 -4.46E-01 -1.25E+00
Retinoblastoma 2D02.2 Uvea 3.97E-02 1.66E-01 9.84E-01
Rheumatoid arthritis FA20 Synovial tissue 6.09E-01 6.27E-02 1.97E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.51E-01 2.25E-02 1.62E-01
Schizophrenia 6A20 Prefrontal cortex 6.83E-02 4.27E-02 1.52E-01
Schizophrenia 6A20 Superior temporal cortex 9.47E-01 2.63E-02 2.07E-01
Scleroderma 4A42.Z Whole blood 2.95E-01 -1.01E-02 -6.51E-02
Seizure 8A60-8A6Z Whole blood 1.99E-01 -1.65E-01 -8.58E-01
Sensitive skin EK0Z Skin 3.41E-01 5.73E-02 2.18E-01
Sepsis with septic shock 1G41 Whole blood 7.46E-02 5.16E-02 1.81E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.60E-01 -4.48E-02 -2.77E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.54E-01 8.73E-02 9.89E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.61E-01 -1.69E-02 -1.11E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.83E-01 -3.85E-01 -1.49E+00
Skin cancer 2C30-2C3Z Skin 4.08E-02 4.69E-02 1.61E-01
Thrombocythemia 3B63 Whole blood 5.62E-01 3.50E-02 2.36E-01
Thrombocytopenia 3B64 Whole blood 5.22E-01 3.86E-01 4.33E-01
Thyroid cancer 2D10 Thyroid 1.39E-09 -3.12E-01 -8.00E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.45E-03 -2.45E-01 -1.38E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.56E-01 1.70E-01 9.10E-01
Type 2 diabetes 5A11 Liver tissue 9.67E-01 -9.73E-02 -2.80E-01
Ureter cancer 2C92 Urothelium 6.63E-01 3.39E-02 2.08E-01
Uterine cancer 2C78 Endometrium tissue 9.49E-02 -6.36E-02 -1.68E-01
Vitiligo ED63.0 Skin 4.91E-02 1.68E-01 1.08E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The neuronal and astrocytic protein SLC38A10 transports glutamine, glutamate, and aspartate, suggesting a role in neurotransmission. FEBS Open Bio. 2017 Apr 26;7(6):730-746.