Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT2N5HO)

DTP Name Sodium/hydrogen exchanger 11 (SLC9C2)
Gene Name SLC9C2
UniProt ID
Q5TAH2 (SL9C2_HUMAN)
VARIDT ID
DTD0498
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms NHE-11; Na(+)/H(+) exchanger 11; SLC9A11; SLC9C2; Solute carrier family 9 member 11; Solute carrier family 9 member C2
DTP Family Monovalent Cation:Proton Antiporter-1 (CPA1) family ;
Sequence
MSSYFWAQNESNRPDLLCGQPADYLVEEKHFTTLVCFIVVLGGLLKMCLKNCEVIVLTIL
SLSGFVIGHMAYNSVEVHQIVYPLLRTSSFSLYSYFSPLIIFMVALDVEFYTLKKMFWQV
LLTGLISFSTASIIIGYVVIKFNKDSWDLQSCLLFSITLGIIDPLRSVNSLKTIGISKIY
IDLIRGESLIICSIASIFFGNFRGNRIHFSIFRDLHVGIELSYDILGSIIFGYWCAKIIQ
CILADVFSNMLTNIILCFSMVYMTFYIVEFLGMSGTLALAAVGLNLDSLTFKPKIELVIT
KFLRIFSSVYEHLIYAFFGIVIGCGELSHYEFHTIPFIFILFTTVNLVRLLTILLVSPIL
MHSNYEYNWRWGVVITWSGIKGVFNLLWAPDVYNLAERKVEVPQMFILYVQVISLLTMGI
NSYVMTQSARKLDLCVLSLPRQMILQNATQHIQEIVQNTITLFKTEKILTNVNWTLVEDK
TRIEYIPFSHVSHNDMKTESTTDEALMEEARLHVAAIQMSSFEKQRNNGILEIEAARILI
GAAKCYYSIQGKFMSIYDVSTYMRTRSWLIKFKNVLTFLEYCIEKIHFIPPESNTFLTFI
FHIVFSEEFEYTGQIINLIYIYPMIIHLWPMARGLNVSALISINYYFMFLYVLESTLKII
ILKRKYFQQCWNTLEFFILVIGIIDIFCVYFVKLRPDNLALIQLTVIMGYLRIIRFLPLF
KIIVPILIRIADVQIKKRLSLMYSITKGYIKSQEDAKLLIKQIAVCESIYQKLCEILETN
KQDAVKELVLMEHEGRDVVIALKTKQAIRNVIAKALKNLTFLCSRGIIDKHEVIEINKVL
LKKLKALNNFPKAIPPPTPDIYLHNIIWLEGKDVLIDFFKERAKLACFDSGDTICKGGEM
PQGIYLIISGMAILHSLSPTFGIESNQRCDRGSRDMFTEFCTTGDIIGELSCLLKREIEY
TVICETSLQACFISLEDLYEGFDAFWPSLEYKIWLKLALSTAYQYFESSLIDEDLRFQNC
VMFNQAYVETLSSYSDMIIDNMTMKFVIIVYGSVIDTKTEEPYFAPCIIPTTCEQVQGTS
DLSKLLIIQASELTQRNSNTNVMASVNTVFEQPGKNINGRQKMS
Function This transporter mediates pH regulation.
Endogenous Substrate(s) Na+; H+
TCDB ID
2.A.36.7.4
Gene ID
284525
Reactome Pathway
Stimuli-sensing channels (R-HSA-2672351 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.82E-03 -4.16E-02 -3.37E-01
Adrenocortical carcinoma 2D11.Z Kidney 5.63E-01 -1.47E-02 -1.14E-01
Alopecia ED70 Skin from scalp 1.61E-01 7.05E-02 3.79E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.03E-01 1.10E-02 9.21E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.11E-01 -4.11E-02 -5.38E-01
Aortic stenosis BB70 Calcified aortic valve 9.01E-01 -9.94E-02 -1.54E-01
Apnea 7A40 Hyperplastic tonsil 3.78E-01 -6.19E-02 -4.21E-01
Arthropathy FA00-FA5Z Peripheral blood 5.93E-02 8.24E-02 1.17E+00
Asthma CA23 Nasal and bronchial airway 1.80E-07 -5.21E-01 -7.06E-01
Atopic dermatitis EA80 Skin 9.74E-01 -1.76E-02 -1.82E-01
Autism 6A02 Whole blood 7.42E-02 -6.42E-02 -5.74E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.26E-01 3.70E-02 3.00E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.61E-01 2.66E-03 2.82E-02
Bacterial infection of gingival 1C1H Gingival tissue 5.11E-01 -2.54E-02 -1.31E-01
Batten disease 5C56.1 Whole blood 8.01E-01 1.35E-02 1.51E-01
Behcet's disease 4A62 Peripheral blood 3.76E-01 -9.32E-03 -7.15E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.34E-01 1.02E-02 1.08E-01
Bladder cancer 2C94 Bladder tissue 4.89E-05 3.63E-01 3.17E+00
Breast cancer 2C60-2C6Z Breast tissue 1.71E-05 -2.90E-02 -1.48E-01
Cardioembolic stroke 8B11.20 Whole blood 4.45E-02 2.89E-02 3.81E-01
Cervical cancer 2C77 Cervical tissue 9.05E-01 1.67E-02 8.29E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.02E-01 7.71E-03 4.58E-02
Chronic hepatitis C 1E51.1 Whole blood 7.97E-02 5.79E-02 5.85E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.80E-02 7.72E-02 6.04E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.23E-01 -1.11E-02 -2.09E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.92E-01 -9.94E-02 -3.13E-01
Colon cancer 2B90 Colon tissue 1.64E-01 -3.37E-02 -2.52E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.82E-01 2.73E-02 1.81E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.14E-01 5.16E-02 5.31E-01
Endometriosis GA10 Endometrium tissue 4.21E-01 3.63E-02 2.14E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.44E-01 7.37E-03 9.29E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.82E-02 -9.04E-02 -6.02E-01
Gastric cancer 2B72 Gastric tissue 2.81E-01 -1.28E-01 -1.48E+00
Glioblastopma 2A00.00 Nervous tissue 4.21E-12 3.63E-02 1.97E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.73E-01 -5.83E-02 -6.07E-01
Head and neck cancer 2D42 Head and neck tissue 4.80E-12 -1.73E-01 -3.18E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.93E-01 -6.20E-02 -3.25E-01
Huntington's disease 8A01.10 Whole blood 9.82E-01 9.34E-03 1.18E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.95E-01 -2.38E-02 -2.10E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.25E-02 9.21E-02 8.53E-01
Influenza 1.00E+30 Whole blood 2.67E-03 2.69E-01 4.49E+00
Interstitial cystitis GC00.3 Bladder tissue 5.82E-01 -3.11E-02 -3.40E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.37E-02 -8.84E-02 -7.56E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.04E-01 1.44E-01 5.14E-01
Ischemic stroke 8B11 Peripheral blood 3.38E-01 4.12E-02 3.55E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.34E-01 4.50E-03 2.31E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 8.49E-01 2.03E-02 7.22E-02
Lateral sclerosis 8B60.4 Skin 7.23E-02 8.34E-02 1.95E+00
Liver cancer 2C12.0 Liver tissue 2.18E-02 -8.43E-02 -4.23E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.77E-01 -3.82E-02 -3.10E-01
Lung cancer 2C25 Lung tissue 1.14E-03 -4.22E-02 -3.70E-01
Lupus erythematosus 4A40 Whole blood 7.82E-02 -5.48E-02 -2.45E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.32E-01 2.47E-03 1.26E-02
Major depressive disorder 6A70-6A7Z Hippocampus 7.69E-01 2.11E-02 2.17E-01
Melanoma 2C30 Skin 3.31E-01 -1.29E-02 -3.76E-02
Multiple myeloma 2A83.1 Bone marrow 1.80E-03 -1.59E-01 -1.93E+00
Multiple myeloma 2A83.1 Peripheral blood 4.55E-02 1.24E-01 1.22E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.81E-01 -2.07E-01 -5.54E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.51E-01 4.56E-03 3.22E-02
Myelofibrosis 2A20.2 Whole blood 1.97E-02 7.36E-02 7.29E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.24E-01 -4.92E-02 -1.64E-01
Myopathy 8C70.6 Muscle tissue 7.48E-01 -2.41E-02 -1.24E-01
Neonatal sepsis KA60 Whole blood 2.43E-01 -4.57E-02 -2.89E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.95E-02 -3.07E-01 -1.19E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.24E-01 3.05E-02 4.56E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.90E-01 5.31E-02 9.61E-01
Olive pollen allergy CA08.00 Peripheral blood 1.23E-01 1.02E-01 2.34E+00
Oral cancer 2B6E Oral tissue 2.13E-04 -1.95E-01 -9.69E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.06E-02 -1.19E-01 -1.71E+00
Osteoporosis FB83.1 Bone marrow 1.25E-01 7.48E-02 4.97E-01
Ovarian cancer 2C73 Ovarian tissue 6.51E-01 -4.85E-02 -4.94E-01
Pancreatic cancer 2C10 Pancreas 1.42E-02 -2.52E-01 -9.84E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.41E-01 -1.65E-02 -2.26E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.99E-01 -2.71E-02 -2.86E-01
Pituitary cancer 2D12 Pituitary tissue 2.99E-01 5.62E-02 2.81E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.37E-01 7.24E-02 4.61E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.49E-01 -7.37E-02 -7.32E-01
Polycythemia vera 2A20.4 Whole blood 6.51E-04 7.50E-02 6.85E-01
Pompe disease 5C51.3 Biceps muscle 2.44E-01 -8.49E-02 -8.36E-01
Preterm birth KA21.4Z Myometrium 2.13E-01 -9.79E-02 -7.43E-01
Prostate cancer 2C82 Prostate 2.76E-01 -1.11E-01 -4.97E-01
Psoriasis EA90 Skin 1.27E-02 -4.80E-02 -2.66E-01
Rectal cancer 2B92 Rectal colon tissue 2.67E-01 -1.46E-01 -9.09E-01
Renal cancer 2C90-2C91 Kidney 1.89E-01 -1.13E-01 -6.28E-01
Retinoblastoma 2D02.2 Uvea 1.37E-06 -2.52E-01 -3.28E+00
Rheumatoid arthritis FA20 Synovial tissue 8.57E-01 3.49E-02 2.12E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.26E-02 -1.06E-01 -5.93E-01
Schizophrenia 6A20 Prefrontal cortex 5.34E-01 2.44E-02 1.76E-01
Schizophrenia 6A20 Superior temporal cortex 4.12E-01 3.42E-02 6.08E-01
Scleroderma 4A42.Z Whole blood 6.85E-01 -4.59E-02 -5.97E-01
Seizure 8A60-8A6Z Whole blood 8.75E-01 -1.01E-02 -6.30E-02
Sensitive skin EK0Z Skin 8.71E-01 -1.64E-02 -2.51E-01
Sepsis with septic shock 1G41 Whole blood 5.03E-01 -5.15E-04 -3.38E-03
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.84E-03 2.81E-01 1.31E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.23E-01 5.34E-02 2.69E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.48E-01 4.65E-02 1.67E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.39E-01 -4.11E-02 -1.72E+00
Skin cancer 2C30-2C3Z Skin 2.64E-12 1.31E-01 7.17E-01
Thrombocythemia 3B63 Whole blood 6.25E-03 5.86E-02 5.43E-01
Thrombocytopenia 3B64 Whole blood 8.60E-01 -1.47E-02 -9.06E-02
Thyroid cancer 2D10 Thyroid 3.85E-01 -3.27E-02 -2.43E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.73E-03 -1.16E-01 -1.15E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.98E-02 1.74E-01 2.05E+00
Type 2 diabetes 5A11 Liver tissue 4.93E-01 -4.61E-02 -3.16E-01
Ureter cancer 2C92 Urothelium 7.75E-01 8.99E-03 9.95E-02
Uterine cancer 2C78 Endometrium tissue 1.16E-02 4.40E-02 2.36E-01
Vitiligo ED63.0 Skin 3.67E-01 6.59E-03 6.89E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases