Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT2UQYR)

DTP Name Mitochondrial 2-oxodicarboxylate carrier (SLC25A21)
Gene Name SLC25A21
UniProt ID
Q9BQT8 (ODC_HUMAN)
VARIDT ID
DTD0182
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ODC; ODC1; SLC25A21; Solute carrier family 25 member 21
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity Ubiquitous.
Sequence
MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSF
RMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSG
LTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHG
VFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQP
VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW
Function
This transporter mediates C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate.
Endogenous Substrate(s) 2-Amino adipate; 2-Oxopimelate; Pimelate; Citrate
TCDB ID
2.A.29.2.4
Gene ID
89874
Reactome Pathway
Lysine catabolism (R-HSA-71064 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
2 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
alpha-ketoglutaric acid DM5LFYN Discovery agent N.A. Investigative [1]
alpha-oxoadipic acid DM0KXN4 Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.86E-37 -1.82E+00 -1.59E+00
Adrenocortical carcinoma 2D11.Z Kidney 7.58E-01 -2.49E-02 -2.31E-01
Alopecia ED70 Skin from scalp 5.18E-02 1.01E-01 2.64E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.13E-01 1.09E-02 8.38E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 8.77E-01 1.20E-02 9.40E-02
Aortic stenosis BB70 Calcified aortic valve 2.85E-01 3.83E-02 1.99E-01
Apnea 7A40 Hyperplastic tonsil 6.42E-01 -4.32E-02 -2.58E-01
Arthropathy FA00-FA5Z Peripheral blood 5.90E-01 -6.54E-03 -6.47E-02
Asthma CA23 Nasal and bronchial airway 1.40E-01 -1.02E-01 -1.10E-01
Atopic dermatitis EA80 Skin 3.39E-01 -7.20E-02 -2.89E-01
Autism 6A02 Whole blood 1.05E-01 2.64E-02 2.59E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.29E-02 8.37E-02 1.02E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.75E-01 -1.31E-02 -1.41E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.49E-05 -1.02E-01 -6.45E-01
Batten disease 5C56.1 Whole blood 7.73E-01 -4.42E-02 -5.68E-01
Behcet's disease 4A62 Peripheral blood 7.42E-01 -1.10E-03 -1.15E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.27E-01 3.05E-03 2.90E-02
Bladder cancer 2C94 Bladder tissue 1.39E-01 4.12E-02 4.70E-01
Breast cancer 2C60-2C6Z Breast tissue 2.40E-01 -7.24E-02 -2.57E-01
Cardioembolic stroke 8B11.20 Whole blood 3.12E-01 1.98E-02 1.53E-01
Cervical cancer 2C77 Cervical tissue 2.85E-01 -1.17E-01 -3.06E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.39E-01 5.30E-03 4.52E-02
Chronic hepatitis C 1E51.1 Whole blood 6.61E-01 1.07E-02 9.26E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 5.21E-01 1.12E-02 7.19E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.27E-02 -5.40E-02 -3.79E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.76E-01 5.46E-02 2.56E-01
Colon cancer 2B90 Colon tissue 8.02E-06 -2.80E-02 -1.66E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.01E-01 -1.14E-01 -6.21E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.43E-01 -4.47E-02 -3.82E-01
Endometriosis GA10 Endometrium tissue 7.06E-01 5.20E-02 1.61E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.72E-01 -6.44E-02 -7.00E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.22E-02 -1.33E-01 -1.34E+00
Gastric cancer 2B72 Gastric tissue 7.43E-02 9.23E-02 5.01E-01
Glioblastopma 2A00.00 Nervous tissue 2.88E-36 8.41E-02 5.27E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.45E-03 3.92E-01 1.24E+00
Head and neck cancer 2D42 Head and neck tissue 2.40E-07 -1.89E-01 -6.98E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.13E-01 -2.58E-02 -2.09E-01
Huntington's disease 8A01.10 Whole blood 7.78E-01 -4.03E-02 -3.52E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.29E-01 -1.26E-01 -1.37E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.76E-02 3.99E-02 6.20E-01
Influenza 1.00E+30 Whole blood 9.83E-01 6.16E-02 5.25E-01
Interstitial cystitis GC00.3 Bladder tissue 7.93E-02 -1.67E-01 -1.35E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.65E-02 -3.18E-01 -1.10E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.09E-01 -7.62E-02 -1.91E-01
Ischemic stroke 8B11 Peripheral blood 4.30E-01 1.14E-02 1.55E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.04E-01 3.31E-02 8.31E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 5.15E-02 1.42E-01 1.23E+00
Lateral sclerosis 8B60.4 Skin 6.72E-01 -2.61E-02 -1.84E-01
Liver cancer 2C12.0 Liver tissue 6.76E-02 -3.14E-02 -1.52E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.11E-02 -2.18E-01 -1.09E+00
Lung cancer 2C25 Lung tissue 3.86E-40 1.52E-01 7.24E-01
Lupus erythematosus 4A40 Whole blood 5.10E-02 4.65E-02 2.80E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.46E-02 4.16E-02 2.76E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.90E-01 -2.56E-02 -2.31E-01
Melanoma 2C30 Skin 5.79E-02 -4.87E-01 -7.35E-01
Multiple myeloma 2A83.1 Bone marrow 2.92E-01 -4.11E-02 -4.53E-01
Multiple myeloma 2A83.1 Peripheral blood 8.83E-01 4.11E-02 3.93E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.99E-01 -1.52E-01 -4.71E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.35E-01 1.53E-01 1.81E-01
Myelofibrosis 2A20.2 Whole blood 1.01E-01 1.55E-01 1.68E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.89E-01 1.89E-02 2.46E-02
Myopathy 8C70.6 Muscle tissue 5.21E-02 1.93E-01 1.02E+00
Neonatal sepsis KA60 Whole blood 1.93E-01 2.44E-03 1.91E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.61E-10 1.75E-01 1.32E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.49E-01 -9.62E-02 -5.60E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.82E-02 -1.48E-01 -1.59E+00
Olive pollen allergy CA08.00 Peripheral blood 7.94E-01 1.01E-01 5.71E-01
Oral cancer 2B6E Oral tissue 4.43E-01 1.09E-03 4.22E-03
Osteoarthritis FA00-FA0Z Synovial tissue 8.94E-01 2.18E-02 1.04E-01
Osteoporosis FB83.1 Bone marrow 1.80E-01 1.64E-01 8.24E-01
Ovarian cancer 2C73 Ovarian tissue 1.21E-01 -1.68E-01 -3.42E-01
Pancreatic cancer 2C10 Pancreas 1.58E-01 -1.24E-01 -3.66E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.03E-01 -2.90E-02 -3.72E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.01E-01 1.23E-02 1.19E-01
Pituitary cancer 2D12 Pituitary tissue 7.51E-01 -1.76E-02 -9.70E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.43E-02 7.88E-02 5.80E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.95E-01 5.20E-02 3.01E-01
Polycythemia vera 2A20.4 Whole blood 1.19E-02 4.47E-02 4.70E-01
Pompe disease 5C51.3 Biceps muscle 4.97E-01 1.17E-01 4.64E-01
Preterm birth KA21.4Z Myometrium 3.05E-01 -4.25E-02 -1.31E+00
Prostate cancer 2C82 Prostate 5.11E-05 1.08E+00 1.69E+00
Psoriasis EA90 Skin 7.01E-01 1.71E-02 5.97E-02
Rectal cancer 2B92 Rectal colon tissue 7.64E-02 -2.72E-01 -1.28E+00
Renal cancer 2C90-2C91 Kidney 2.01E-02 -1.80E-02 -7.36E-02
Retinoblastoma 2D02.2 Uvea 5.54E-02 -1.39E-01 -5.63E-01
Rheumatoid arthritis FA20 Synovial tissue 4.25E-01 -1.33E-01 -6.60E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.01E-01 2.63E-03 2.35E-02
Schizophrenia 6A20 Prefrontal cortex 7.88E-01 -2.69E-02 -2.32E-01
Schizophrenia 6A20 Superior temporal cortex 9.21E-01 4.21E-02 5.39E-01
Scleroderma 4A42.Z Whole blood 9.23E-02 1.01E-01 7.27E-01
Seizure 8A60-8A6Z Whole blood 6.93E-01 2.56E-02 1.66E-01
Sensitive skin EK0Z Skin 8.69E-01 7.34E-03 2.53E-02
Sepsis with septic shock 1G41 Whole blood 4.26E-06 6.30E-02 3.89E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.25E-01 4.64E-01 5.87E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.65E-01 1.13E-02 7.31E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 6.75E-01 -4.37E-02 -1.99E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.24E-02 1.32E-01 1.67E+00
Skin cancer 2C30-2C3Z Skin 7.56E-08 7.67E-02 1.76E-01
Thrombocythemia 3B63 Whole blood 5.87E-03 5.71E-02 6.09E-01
Thrombocytopenia 3B64 Whole blood 6.72E-01 1.76E-02 5.98E-02
Thyroid cancer 2D10 Thyroid 6.95E-01 -1.17E-01 -2.32E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.60E-01 -7.08E-02 -4.37E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.58E-01 -8.16E-02 -4.91E-01
Type 2 diabetes 5A11 Liver tissue 9.69E-02 -5.36E-02 -7.85E-01
Ureter cancer 2C92 Urothelium 1.87E-01 3.88E-02 2.75E-01
Uterine cancer 2C78 Endometrium tissue 5.02E-01 -2.92E-02 -1.01E-01
Vitiligo ED63.0 Skin 1.39E-01 -2.81E-01 -1.20E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Mitochondrial oxodicarboxylate carrier deficiency is associated with mitochondrial DNA depletion and spinal muscular atrophy-like disease. Genet Med. 2018 Oct;20(10):1224-1235.