Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT3BI6S)

DTP Name Glucose transporter type 10 (SLC2A10)
Gene Name SLC2A10
UniProt ID
O95528 (GTR10_HUMAN)
VARIDT ID
DTD0252
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ATORS; ATS; GLUT-10; GLUT10; SLC2A10; Solute carrier family 2, facilitated glucose transporter member 10
DTP Family Major Facilitator Superfamily (MFS)
Sugar Porter (SP) Family
Tissue Specificity Widely expressed; highest levels in liver andpancreas.
Sequence
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
ASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACC
IYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSL
SLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRGRTTVGLGLVL
FQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL
LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTN
EDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFL
LYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAA
S
Function This transporter facilitates glucose transporter.
Endogenous Substrate(s) Glucose
TCDB ID
2.A.1.1.59
Gene ID
81031
Reactome Pathway
Defective SLC2A10 causes arterial tortuosity syndrome (ATS) (R-HSA-5619068 )
Cellular hexose transport (R-HSA-189200 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
2-deoxyglucose DMIAHVU Solid tumour/cancer 2A00-2F9Z Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.70E-11 -4.24E-01 -7.14E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.75E-06 -1.09E+00 -1.63E+00
Alopecia ED70 Skin from scalp 2.53E-05 3.85E-01 7.27E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.33E-05 2.85E-01 3.88E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.87E-01 -2.35E-02 -9.67E-02
Aortic stenosis BB70 Calcified aortic valve 9.68E-01 9.76E-02 5.90E-02
Apnea 7A40 Hyperplastic tonsil 2.93E-01 5.19E-01 1.10E+00
Arthropathy FA00-FA5Z Peripheral blood 6.18E-01 4.48E-02 3.15E-01
Asthma CA23 Nasal and bronchial airway 6.37E-01 -1.32E-04 -1.81E-04
Atopic dermatitis EA80 Skin 1.99E-05 -3.90E-01 -9.02E-01
Autism 6A02 Whole blood 9.66E-01 -6.17E-02 -3.80E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.03E-01 -4.32E-02 -3.26E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.42E-01 -1.59E-01 -1.06E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.25E-13 9.68E-01 1.39E+00
Batten disease 5C56.1 Whole blood 3.87E-01 -1.24E-02 -3.98E-02
Behcet's disease 4A62 Peripheral blood 7.68E-01 -6.43E-02 -2.03E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.61E-03 2.71E-01 6.99E-01
Bladder cancer 2C94 Bladder tissue 1.03E-07 -7.54E-01 -4.28E+00
Breast cancer 2C60-2C6Z Breast tissue 1.10E-55 1.10E+00 1.57E+00
Cardioembolic stroke 8B11.20 Whole blood 3.87E-01 -1.24E-01 -2.28E-01
Cervical cancer 2C77 Cervical tissue 8.33E-01 -4.26E-02 -4.48E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.20E-01 1.99E-02 1.39E-01
Chronic hepatitis C 1E51.1 Whole blood 2.01E-02 1.54E-01 2.25E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 8.61E-03 -2.99E-01 -8.20E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.18E-02 -1.41E-01 -3.85E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.96E-01 -7.32E-02 -1.19E-01
Colon cancer 2B90 Colon tissue 3.76E-17 -4.66E-01 -7.31E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.01E-01 2.90E-01 7.50E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.63E-01 7.74E-02 4.79E-01
Endometriosis GA10 Endometrium tissue 3.63E-01 1.58E-02 1.79E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.95E-01 -7.69E-02 -4.16E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.32E-01 -4.21E-03 -3.46E-02
Gastric cancer 2B72 Gastric tissue 6.85E-01 -9.35E-02 -1.10E-01
Glioblastopma 2A00.00 Nervous tissue 3.69E-146 2.26E+00 2.49E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.18E-01 3.66E-01 3.19E-01
Head and neck cancer 2D42 Head and neck tissue 2.81E-13 -1.53E+00 -9.78E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.56E-01 6.74E-02 1.57E-01
Huntington's disease 8A01.10 Whole blood 2.23E-01 3.34E-02 3.01E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.28E-02 3.92E-01 7.54E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.01E-01 -1.58E-02 -1.26E-01
Influenza 1.00E+30 Whole blood 2.90E-01 -1.02E-01 -1.36E+00
Interstitial cystitis GC00.3 Bladder tissue 6.77E-03 -3.55E-01 -2.42E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.16E-06 1.54E+00 2.56E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.25E-02 -1.07E-01 -4.36E-01
Ischemic stroke 8B11 Peripheral blood 8.47E-01 -7.37E-02 -5.18E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.02E-01 2.29E-02 5.06E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 5.58E-01 5.74E-03 1.00E-02
Lateral sclerosis 8B60.4 Skin 4.24E-01 1.89E-02 5.38E-02
Liver cancer 2C12.0 Liver tissue 3.06E-05 -1.65E-01 -1.73E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.16E-09 -3.25E+00 -6.05E+00
Lung cancer 2C25 Lung tissue 2.99E-05 3.05E-01 6.15E-01
Lupus erythematosus 4A40 Whole blood 2.30E-01 9.74E-04 3.43E-03
Major depressive disorder 6A70-6A7Z Whole blood 1.74E-01 3.22E-02 1.42E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.32E-01 -1.48E-01 -3.62E-01
Melanoma 2C30 Skin 7.74E-01 7.96E-01 5.37E-01
Multiple myeloma 2A83.1 Bone marrow 3.02E-02 -3.94E-01 -1.76E+00
Multiple myeloma 2A83.1 Peripheral blood 5.89E-01 -3.98E-02 -7.92E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.00E-01 -2.93E-02 -8.67E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.43E-03 4.82E-01 5.65E-01
Myelofibrosis 2A20.2 Whole blood 1.77E-01 4.06E-02 2.63E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.00E-01 -1.27E-01 -1.28E-01
Myopathy 8C70.6 Muscle tissue 2.90E-03 5.29E-01 1.13E+00
Neonatal sepsis KA60 Whole blood 4.94E-02 4.10E-02 2.55E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.00E-05 2.27E+00 2.59E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.27E-01 -7.54E-01 -1.19E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.09E-01 2.24E-01 3.90E-01
Olive pollen allergy CA08.00 Peripheral blood 8.20E-02 1.15E-01 9.40E-01
Oral cancer 2B6E Oral tissue 3.67E-03 1.16E+00 8.71E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.10E-01 6.28E-01 5.41E-01
Osteoporosis FB83.1 Bone marrow 7.66E-01 -3.10E-01 -5.03E-01
Ovarian cancer 2C73 Ovarian tissue 1.51E-02 4.50E-01 1.08E+00
Pancreatic cancer 2C10 Pancreas 1.29E-03 7.59E-01 1.04E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.91E-01 -1.20E-01 -7.66E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.82E-01 -2.86E-02 -2.51E-01
Pituitary cancer 2D12 Pituitary tissue 1.37E-05 -2.06E+00 -3.23E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.12E-08 -2.49E+00 -6.56E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.90E-01 -9.54E-02 -4.11E-01
Polycythemia vera 2A20.4 Whole blood 5.43E-01 3.53E-02 2.54E-01
Pompe disease 5C51.3 Biceps muscle 9.62E-01 1.26E-01 2.53E-01
Preterm birth KA21.4Z Myometrium 5.97E-01 2.88E-01 3.29E-01
Prostate cancer 2C82 Prostate 6.53E-01 3.26E-01 4.74E-01
Psoriasis EA90 Skin 1.47E-05 -4.51E-01 -5.15E-01
Rectal cancer 2B92 Rectal colon tissue 9.23E-04 -9.95E-01 -2.30E+00
Renal cancer 2C90-2C91 Kidney 5.92E-02 6.48E-01 5.43E-01
Retinoblastoma 2D02.2 Uvea 8.40E-11 3.59E+00 7.34E+00
Rheumatoid arthritis FA20 Synovial tissue 6.32E-02 3.28E-01 3.93E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.85E-01 3.06E-02 1.33E-01
Schizophrenia 6A20 Prefrontal cortex 5.32E-01 -1.36E-01 -1.82E-01
Schizophrenia 6A20 Superior temporal cortex 7.32E-01 3.07E-02 6.94E-02
Scleroderma 4A42.Z Whole blood 2.18E-01 -2.54E-02 -1.48E-01
Seizure 8A60-8A6Z Whole blood 5.02E-03 -8.62E-02 -6.12E-01
Sensitive skin EK0Z Skin 2.43E-01 -2.88E-01 -1.30E+00
Sepsis with septic shock 1G41 Whole blood 4.74E-06 6.24E-02 3.60E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.06E-02 -8.70E-01 -1.53E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.90E-01 5.34E-03 1.83E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 3.55E-01 -9.25E-02 -4.69E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.10E-03 5.99E-01 3.73E+00
Skin cancer 2C30-2C3Z Skin 3.16E-02 -6.79E-03 -7.26E-03
Thrombocythemia 3B63 Whole blood 5.53E-02 8.86E-02 6.04E-01
Thrombocytopenia 3B64 Whole blood 7.07E-01 1.82E-01 4.34E-01
Thyroid cancer 2D10 Thyroid 2.22E-02 -1.10E-01 -2.08E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.23E-10 2.75E+00 3.92E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.94E-03 1.10E+00 2.47E+00
Type 2 diabetes 5A11 Liver tissue 7.48E-03 4.04E-01 1.94E+00
Ureter cancer 2C92 Urothelium 9.09E-01 -2.99E-01 -9.36E-01
Uterine cancer 2C78 Endometrium tissue 8.09E-14 -5.75E-01 -7.24E-01
Vitiligo ED63.0 Skin 7.94E-01 2.28E-01 4.45E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)
Drug Name Highest Status Cell Line Affinity REF
2-deoxyglucose Approved Xenopus oocytes-GLUT10 Km = 300.0 microM [1]

References

1 Sequence and functional analysis of GLUT10: a glucose transporter in the Type 2 diabetes-linked region of chromosome 20q12-13.1. Mol Genet Metab. 2001 Sep-Oct;74(1-2):186-99.