Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT3KH2X)

DTP Name Sodium-dependent vitamin C transporter 1 (SLC23A1)
Gene Name SLC23A1
UniProt ID
Q9UHI7 (S23A1_HUMAN)
VARIDT ID
DTD0158
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Na(+)/L-ascorbic acid transporter 1; SLC23A1; SVCT1; Solute carrier family 23 member 1; YSPL3; Yolk sac permease-like molecule 3; hSVCT1
DTP Family Nucleobase/Ascorbate Transporter (NAT) Or Nucleobase:Cation Symporter-2 (NCS2) Family ;
Tissue Specificity Highly expressed in adult small intestine,kidney, thymus, ovary, colon, prostate and liver, and in fetalkidney, liver and thymus.
Sequence
MRAQEDLEGRTQHETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTI
AVPFLLAEALCVGHDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKA
ILALERWKCPPEEEIYGNWSLPLNTSHIWHPRIREVQGAIMVSSVVEVVIGLLGLPGALL
NYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIILFSQYLRNLTFLLPVYRW
GKGLTLLRIQIFKMFPIMLAIMTVWLLCYVLTLTDVLPTDPKAYGFQARTDARGDIMAIA
PWIRIPYPCQWGLPTVTAAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPVHAINRGI
FTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAAIMLVLGTIGKFTALF
ASLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLESNPG
AINTGILEVDQILIVLLTTEMFVGGCLAFILDNTVPGSPEERGLIQWKAGAHANSDMSSS
LKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETASVCTKV
Function This sodium/ascorbate cotransporter mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
Endogenous Substrate(s) Na+
TCDB ID
2.A.40.6.5
Gene ID
9963
KEGG Pathway
Vitamin digestion and absorption (hsa04977 )
Reactome Pathway
Vitamin C (ascorbate) metabolism (R-HSA-196836 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin C DMXJ7O8 Adenocarcinoma 2D40 Approved [3]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.51E-08 8.94E-02 4.80E-01
Adrenocortical carcinoma 2D11.Z Kidney 4.91E-01 -1.93E-02 -7.97E-02
Alopecia ED70 Skin from scalp 4.81E-01 1.72E-01 4.32E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.56E-01 -6.87E-02 -4.10E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.34E-01 -7.76E-02 -8.17E-01
Aortic stenosis BB70 Calcified aortic valve 7.76E-01 1.87E-01 2.03E-01
Apnea 7A40 Hyperplastic tonsil 3.73E-01 -4.08E-02 -1.41E-01
Arthropathy FA00-FA5Z Peripheral blood 4.15E-01 3.21E-02 2.61E-01
Asthma CA23 Nasal and bronchial airway 2.87E-03 -5.26E-01 -3.91E-01
Atopic dermatitis EA80 Skin 9.96E-02 -1.74E-01 -5.67E-01
Autism 6A02 Whole blood 9.74E-01 -4.42E-02 -2.22E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.04E-02 -7.87E-02 -5.55E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.28E-01 -5.61E-02 -3.13E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.79E-01 1.62E-02 5.86E-02
Batten disease 5C56.1 Whole blood 7.91E-01 1.32E-01 7.09E-01
Behcet's disease 4A62 Peripheral blood 7.82E-01 3.59E-02 1.52E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.93E-01 -2.41E-02 -1.21E-01
Bladder cancer 2C94 Bladder tissue 1.76E-05 9.42E-01 3.89E+00
Breast cancer 2C60-2C6Z Breast tissue 1.11E-08 8.62E-02 2.63E-01
Cardioembolic stroke 8B11.20 Whole blood 2.07E-05 2.82E-01 8.27E-01
Cervical cancer 2C77 Cervical tissue 3.96E-01 2.28E-02 7.22E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.29E-01 -6.98E-03 -3.94E-02
Chronic hepatitis C 1E51.1 Whole blood 2.12E-01 -2.38E-02 -2.17E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.26E-01 5.75E-02 1.83E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.26E-01 3.42E-02 3.94E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.14E-03 -1.47E+00 -2.10E+00
Colon cancer 2B90 Colon tissue 8.55E-44 -1.44E+00 -1.62E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.80E-02 -2.71E-01 -1.32E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.30E-01 2.93E-01 6.50E-01
Endometriosis GA10 Endometrium tissue 8.79E-01 1.88E-01 3.03E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.91E-01 3.38E-02 2.55E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.10E-01 -1.28E-01 -7.59E-01
Gastric cancer 2B72 Gastric tissue 2.76E-01 -3.39E-01 -1.71E+00
Glioblastopma 2A00.00 Nervous tissue 5.67E-01 -3.08E-02 -1.08E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.79E-01 6.47E-02 2.66E-01
Head and neck cancer 2D42 Head and neck tissue 1.59E-11 -2.71E-01 -1.60E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.87E-01 -8.83E-02 -2.23E-01
Huntington's disease 8A01.10 Whole blood 3.29E-01 -2.57E-03 -2.54E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.46E-01 6.11E-01 1.26E+00
Immunodeficiency 4A00-4A20 Peripheral blood 6.10E-01 -4.57E-02 -4.70E-01
Influenza 1.00E+30 Whole blood 1.31E-01 6.13E-02 4.82E-01
Interstitial cystitis GC00.3 Bladder tissue 9.18E-02 9.22E-02 1.03E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.63E-01 4.82E-02 4.06E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.75E-01 -1.97E-01 -4.17E-01
Ischemic stroke 8B11 Peripheral blood 9.02E-01 4.67E-02 2.10E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.61E-01 -3.85E-02 -9.36E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.49E-01 -1.71E-01 -9.59E-01
Lateral sclerosis 8B60.4 Skin 6.89E-01 -3.87E-03 -2.40E-02
Liver cancer 2C12.0 Liver tissue 1.71E-01 1.13E-02 1.44E-02
Liver failure DB99.7-DB99.8 Liver tissue 6.05E-02 -8.26E-01 -1.00E+00
Lung cancer 2C25 Lung tissue 1.23E-02 -8.03E-02 -1.62E-01
Lupus erythematosus 4A40 Whole blood 1.32E-01 -3.60E-02 -1.25E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.73E-02 -1.28E-01 -2.50E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.51E-01 -5.82E-02 -3.38E-01
Melanoma 2C30 Skin 4.11E-02 -1.83E-01 -2.40E-01
Multiple myeloma 2A83.1 Bone marrow 8.70E-03 -4.63E-01 -1.79E+00
Multiple myeloma 2A83.1 Peripheral blood 3.95E-01 1.74E-01 1.06E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.77E-02 3.44E-01 9.58E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.08E-06 -6.73E-01 -1.32E+00
Myelofibrosis 2A20.2 Whole blood 6.99E-01 5.45E-02 3.60E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.82E-01 -1.07E-01 -1.22E-01
Myopathy 8C70.6 Muscle tissue 4.56E-01 -2.49E-02 -1.83E-01
Neonatal sepsis KA60 Whole blood 9.72E-03 -1.03E-01 -5.38E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.19E-03 -4.73E-01 -1.16E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.84E-01 5.06E-01 7.94E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.43E-01 7.35E-02 5.42E-01
Olive pollen allergy CA08.00 Peripheral blood 4.48E-01 8.34E-03 4.01E-02
Oral cancer 2B6E Oral tissue 4.38E-02 -1.01E-01 -2.68E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.58E-01 -9.34E-02 -3.18E-01
Osteoporosis FB83.1 Bone marrow 1.23E-01 8.62E-02 7.52E-01
Ovarian cancer 2C73 Ovarian tissue 7.04E-01 1.69E-01 1.69E-01
Pancreatic cancer 2C10 Pancreas 6.95E-03 -4.54E-01 -9.95E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.14E-01 -1.03E-01 -6.83E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.24E-01 -1.10E-02 -5.97E-02
Pituitary cancer 2D12 Pituitary tissue 4.48E-01 1.13E-02 8.14E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.99E-01 5.49E-02 2.46E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.21E-01 -1.95E-02 -9.79E-02
Polycythemia vera 2A20.4 Whole blood 3.96E-02 4.27E-02 3.52E-01
Pompe disease 5C51.3 Biceps muscle 1.72E-01 -1.77E-01 -8.13E-01
Preterm birth KA21.4Z Myometrium 9.90E-01 -7.73E-03 -7.88E-02
Prostate cancer 2C82 Prostate 5.58E-04 1.30E+00 1.62E+00
Psoriasis EA90 Skin 4.40E-25 8.69E-01 1.84E+00
Rectal cancer 2B92 Rectal colon tissue 2.84E-02 -5.01E-01 -1.19E+00
Renal cancer 2C90-2C91 Kidney 7.85E-03 -2.21E+00 -1.33E+00
Retinoblastoma 2D02.2 Uvea 7.08E-02 -1.58E-01 -1.28E+00
Rheumatoid arthritis FA20 Synovial tissue 6.10E-01 1.03E-02 2.37E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.97E-01 -1.29E-01 -2.42E-01
Schizophrenia 6A20 Prefrontal cortex 7.02E-01 2.78E-03 9.71E-03
Schizophrenia 6A20 Superior temporal cortex 3.33E-01 -5.46E-02 -5.59E-01
Scleroderma 4A42.Z Whole blood 1.57E-01 1.21E-01 7.80E-01
Seizure 8A60-8A6Z Whole blood 8.35E-01 3.12E-02 1.80E-01
Sensitive skin EK0Z Skin 1.30E-01 -3.27E-01 -9.80E-01
Sepsis with septic shock 1G41 Whole blood 3.16E-02 -6.36E-03 -2.98E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.70E-01 -9.86E-02 -5.90E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.22E-01 -1.39E-02 -1.26E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.49E-01 3.27E-02 1.12E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.91E-01 -2.79E-01 -1.19E+00
Skin cancer 2C30-2C3Z Skin 4.39E-12 -4.44E-01 -7.58E-01
Thrombocythemia 3B63 Whole blood 5.41E-02 7.68E-02 6.06E-01
Thrombocytopenia 3B64 Whole blood 5.62E-01 5.27E-02 2.35E-01
Thyroid cancer 2D10 Thyroid 4.44E-03 4.06E-02 1.75E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.79E-01 1.35E-02 8.14E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.55E-01 1.60E-02 5.98E-02
Type 2 diabetes 5A11 Liver tissue 2.34E-01 4.37E-01 5.80E-01
Ureter cancer 2C92 Urothelium 3.96E-01 -5.57E-02 -2.53E-01
Uterine cancer 2C78 Endometrium tissue 1.41E-09 -5.76E-01 -7.83E-01
Vitiligo ED63.0 Skin 4.50E-01 -3.19E-01 -3.25E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 23 member 1 (SLC23A1) DTT Info
DTP DTT Type Successful
1 Approved Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin C DMXJ7O8 Adenocarcinoma 2D40 Approved [1]
------------------------------------------------------------------------------------
1 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
phloretin DMYA50U Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------

References

1 Decreased expression of the vitamin C transporter SVCT1 by ascorbic acid in a human intestinal epithelial cell line. Br J Nutr. 2002 Feb;87(2):97-100.
2 A family of mammalian Na+-dependent L-ascorbic acid transporters. Nature. 1999 May 6;399(6731):70-5.
3 A family of mammalian Na+-dependent L-ascorbic acid transporters. Nature. 1999 May 6;399(6731):70-5.