Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT3LZWR)

DTP Name GDP-fucose transporter 1 (SLC35C1)
Gene Name SLC35C1
UniProt ID
Q96A29 (FUCT1_HUMAN)
VARIDT ID
DTD0296
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms CDG2C; FUCT1; SLC35C1; Solute carrier family 35 member C1
DTP Family Drug/Metabolite Transporter (DMT) Superfamily
GDP-fucose Transporter (GFT) Family
Sequence
MNRAPLKRSRILHMALTGASDPSAEAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNK
YLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPL
SVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGG
FWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACI
LFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSG
TAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKTPEEPSPKDSEKS
AMGV
Function This transporter involved in GDP-fucose import from the cytoplasm into the Golgi lumen.
Endogenous Substrate(s) GDP-fucose
TCDB ID
2.A.7.16.1
Gene ID
55343
Reactome Pathway
GDP-fucose biosynthesis (R-HSA-6787639 )
Transport of nucleotide sugars (R-HSA-727802 )
Defective SLC35C1 causes congenital disorder of glycosylation 2C (CDG2C) (R-HSA-5619078 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
GDP-fucose DMZMULS Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.96E-08 1.46E-01 5.36E-01
Adrenocortical carcinoma 2D11.Z Kidney 6.79E-01 -5.03E-02 -1.68E-01
Alopecia ED70 Skin from scalp 4.15E-01 -8.19E-02 -4.15E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.23E-04 -5.02E-02 -3.57E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.73E-01 1.76E-01 8.74E-01
Aortic stenosis BB70 Calcified aortic valve 4.41E-01 2.10E-01 5.37E-01
Apnea 7A40 Hyperplastic tonsil 4.40E-01 5.75E-01 3.52E+00
Arthropathy FA00-FA5Z Peripheral blood 2.69E-01 -8.31E-02 -7.44E-01
Asthma CA23 Nasal and bronchial airway 1.23E-03 3.68E-01 5.87E-01
Atopic dermatitis EA80 Skin 3.77E-04 1.10E-01 1.26E+00
Autism 6A02 Whole blood 5.75E-02 -5.87E-02 -3.72E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.66E-01 -9.10E-02 -9.23E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.75E-01 -4.91E-02 -3.49E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.10E-01 6.71E-02 2.45E-01
Batten disease 5C56.1 Whole blood 5.57E-01 -5.58E-02 -6.29E-01
Behcet's disease 4A62 Peripheral blood 8.84E-01 9.25E-02 5.44E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.32E-01 1.40E-02 9.83E-02
Bladder cancer 2C94 Bladder tissue 5.69E-01 -8.64E-02 -3.10E-01
Breast cancer 2C60-2C6Z Breast tissue 4.29E-08 -1.80E-01 -4.57E-01
Cardioembolic stroke 8B11.20 Whole blood 2.29E-02 5.54E-02 4.00E-01
Cervical cancer 2C77 Cervical tissue 3.73E-06 -4.92E-01 -1.79E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.54E-01 5.58E-03 2.68E-02
Chronic hepatitis C 1E51.1 Whole blood 4.56E-01 -2.35E-02 -1.86E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.25E-01 -9.68E-02 -4.55E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.77E-01 6.10E-02 1.50E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.71E-02 3.20E-01 3.43E+00
Colon cancer 2B90 Colon tissue 3.19E-21 -2.76E-01 -9.11E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.35E-01 2.43E-01 6.30E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.28E-01 -7.74E-02 -2.89E-01
Endometriosis GA10 Endometrium tissue 8.91E-02 3.15E-01 7.33E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.63E-01 8.53E-02 7.04E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.54E-01 2.79E-02 1.45E-01
Gastric cancer 2B72 Gastric tissue 1.23E-01 1.73E-01 8.77E-01
Glioblastopma 2A00.00 Nervous tissue 1.45E-26 -1.43E-01 -6.38E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.64E-02 2.80E-01 8.84E-01
Head and neck cancer 2D42 Head and neck tissue 1.65E-25 -7.62E-01 -1.58E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.67E-01 -2.89E-02 -2.69E-01
Huntington's disease 8A01.10 Whole blood 5.94E-01 3.90E-02 2.51E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.02E-01 9.49E-03 9.14E-02
Immunodeficiency 4A00-4A20 Peripheral blood 8.85E-02 1.11E-01 1.53E+00
Influenza 1.00E+30 Whole blood 5.90E-02 -1.86E-01 -4.77E+00
Interstitial cystitis GC00.3 Bladder tissue 3.66E-01 1.21E-02 5.17E-02
Intracranial aneurysm 8B01.0 Intracranial artery 7.32E-03 3.00E-01 1.12E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.32E-02 -8.55E-02 -2.63E-01
Ischemic stroke 8B11 Peripheral blood 8.22E-01 1.44E-02 1.06E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.13E-04 -1.41E-01 -4.19E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.56E-01 8.63E-02 3.08E-01
Lateral sclerosis 8B60.4 Skin 7.91E-01 3.02E-02 2.76E-01
Liver cancer 2C12.0 Liver tissue 9.56E-02 -6.70E-03 -7.91E-03
Liver failure DB99.7-DB99.8 Liver tissue 2.91E-03 -1.38E+00 -2.09E+00
Lung cancer 2C25 Lung tissue 1.79E-06 1.03E-01 4.35E-01
Lupus erythematosus 4A40 Whole blood 4.83E-02 -4.08E-02 -1.43E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.85E-01 3.33E-02 1.17E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.00E-01 2.65E-02 1.94E-01
Melanoma 2C30 Skin 8.15E-02 3.21E-01 4.78E-01
Multiple myeloma 2A83.1 Bone marrow 1.75E-04 4.50E-01 2.41E+00
Multiple myeloma 2A83.1 Peripheral blood 9.94E-01 -1.30E-01 -4.38E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.00E-02 -1.83E-01 -1.43E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.78E-06 1.54E-01 1.08E+00
Myelofibrosis 2A20.2 Whole blood 3.67E-01 9.35E-04 7.35E-03
Myocardial infarction BA41-BA50 Peripheral blood 6.57E-03 -2.67E-01 -8.64E-01
Myopathy 8C70.6 Muscle tissue 4.04E-03 -1.35E-01 -1.49E+00
Neonatal sepsis KA60 Whole blood 4.06E-02 -6.92E-02 -3.67E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.71E-02 -1.45E-01 -3.70E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.01E-01 1.59E-01 2.68E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.02E-01 2.51E-01 4.96E-01
Olive pollen allergy CA08.00 Peripheral blood 6.62E-02 1.83E-01 1.45E+00
Oral cancer 2B6E Oral tissue 4.17E-06 -5.15E-01 -1.13E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.45E-01 1.71E-01 3.12E-01
Osteoporosis FB83.1 Bone marrow 2.15E-02 2.42E-01 1.80E+00
Ovarian cancer 2C73 Ovarian tissue 6.11E-02 1.09E-01 3.38E-01
Pancreatic cancer 2C10 Pancreas 8.13E-05 3.26E-01 1.16E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 8.11E-01 -5.42E-02 -3.00E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.49E-01 -2.18E-04 -1.76E-03
Pituitary cancer 2D12 Pituitary tissue 1.22E-03 -3.25E-01 -1.66E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.74E-06 -6.14E-01 -3.12E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.84E-01 -3.30E-02 -2.54E-01
Polycythemia vera 2A20.4 Whole blood 2.69E-04 1.26E-01 9.02E-01
Pompe disease 5C51.3 Biceps muscle 3.47E-01 9.02E-02 5.12E-01
Preterm birth KA21.4Z Myometrium 6.78E-02 -2.18E-01 -6.55E-01
Prostate cancer 2C82 Prostate 1.26E-03 -3.58E-01 -9.95E-01
Psoriasis EA90 Skin 8.09E-03 -6.42E-02 -1.95E-01
Rectal cancer 2B92 Rectal colon tissue 4.12E-02 -2.50E-01 -9.93E-01
Renal cancer 2C90-2C91 Kidney 2.91E-01 4.98E-02 2.64E-01
Retinoblastoma 2D02.2 Uvea 4.46E-02 1.90E-01 1.39E+00
Rheumatoid arthritis FA20 Synovial tissue 1.02E-02 4.24E-01 1.68E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.33E-01 -5.04E-02 -2.38E-01
Schizophrenia 6A20 Prefrontal cortex 2.61E-01 3.16E-02 1.13E-01
Schizophrenia 6A20 Superior temporal cortex 6.90E-01 -4.73E-03 -8.92E-02
Scleroderma 4A42.Z Whole blood 6.46E-01 -2.07E-03 -1.58E-02
Seizure 8A60-8A6Z Whole blood 3.25E-01 -1.27E-01 -8.32E-01
Sensitive skin EK0Z Skin 8.16E-01 -3.35E-02 -2.17E-01
Sepsis with septic shock 1G41 Whole blood 8.56E-07 -7.47E-02 -4.22E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.77E-01 9.39E-02 9.42E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.61E-01 -4.34E-02 -1.69E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.83E-01 -7.48E-03 -3.19E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.95E-01 -3.78E-02 -1.39E-01
Skin cancer 2C30-2C3Z Skin 7.22E-01 -7.39E-03 -2.01E-02
Thrombocythemia 3B63 Whole blood 1.91E-01 7.42E-03 5.60E-02
Thrombocytopenia 3B64 Whole blood 4.99E-01 5.72E-01 6.52E-01
Thyroid cancer 2D10 Thyroid 2.68E-12 1.99E-01 1.02E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.98E-01 -6.68E-03 -2.31E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.27E-01 1.34E-01 3.54E+00
Type 2 diabetes 5A11 Liver tissue 3.33E-01 2.71E-01 1.04E+00
Ureter cancer 2C92 Urothelium 4.66E-02 -1.19E-01 -1.01E+00
Uterine cancer 2C78 Endometrium tissue 6.52E-15 -3.98E-01 -6.59E-01
Vitiligo ED63.0 Skin 3.71E-01 -8.33E-02 -4.26E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Golgi GDP-fucose transporter-deficient mice mimic congenital disorder of glycosylation IIc/leukocyte adhesion deficiency II. J Biol Chem. 2007 Apr 6;282(14):10762-72.