Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT3Q1UO)

DTP Name Protein spinster homolog 2 (SLC63A2)
Gene Name SLC63A2
UniProt ID
Q8IVW8 (SPNS2_HUMAN)
VARIDT ID
DTD0435
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SPNS2; Spinster homolog 2
DTP Family Major Facilitator Superfamily (MFS)
Endosomal Spinster (Spinster) Family
Sequence
MMCLECASAAAGGAEEEEADAERRRRRRGAQRGAGGSGCCGARGAGGAGVSAAGDEVQTL
SGSVRRAPTGPPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
TVAGVLLDIQQHFGVKDRGAGLLQSVFICSFMVAAPIFGYLGDRFNRKVILSCGIFFWSA
VTFSSSFIPQQYFWLLVLSRGLVGIGEASYSTIAPTIIGDLFTKNTRTLMLSVFYFAIPL
GSGLGYITGSSVKQAAGDWHWALRVSPVLGMITGTLILILVPATKRGHADQLGDQLKART
SWLRDMKALIRNRSYVFSSLATSAVSFATGALGMWIPLYLHRAQVVQKTAETCNSPPCGA
KDSLIFGAITCFTGFLGVVTGAGATRWCRLKTQRADPLVCAVGMLGSAIFICLIFVAAKS
SIVGAYICIFVGETLLFSNWAITADILMYVVIPTRRATAVALQSFTSHLLGDAGSPYLIG
FISDLIRQSTKDSPLWEFLSLGYALMLCPFVVVLGGMFFLATALFFVSDRARAEQQVNQL
AMPPASVKV
Function
This transporter mediates the transport of sphingosine 1-phosphate (S1P) in the extraembryonic yolk syncytial layer (YSL), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function.
Endogenous Substrate(s) Dehydroshpingosine-1-P
TCDB ID
2.A.1.49.6
Gene ID
124976
Reactome Pathway
Sphingolipid de novo biosynthesis (R-HSA-1660661 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Clinical Trial Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sphingosine-1-phosphate DMJCQKA Acne vulgaris ED80 Phase 1 [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.15E-24 8.08E-01 1.88E+00
Adrenocortical carcinoma 2D11.Z Kidney 4.93E-02 -1.38E-01 -4.37E-01
Alopecia ED70 Skin from scalp 8.88E-02 -1.14E-01 -4.23E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.66E-02 1.11E-01 3.06E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.90E-01 -1.09E-02 -1.06E-01
Aortic stenosis BB70 Calcified aortic valve 4.46E-02 4.84E-01 8.92E-01
Apnea 7A40 Hyperplastic tonsil 1.01E-01 1.71E+00 2.26E+00
Arthropathy FA00-FA5Z Peripheral blood 7.86E-01 -1.01E-01 -3.38E-01
Asthma CA23 Nasal and bronchial airway 1.76E-04 4.56E-01 4.40E-01
Atopic dermatitis EA80 Skin 2.18E-02 -2.34E-01 -1.24E+00
Autism 6A02 Whole blood 2.43E-01 -5.69E-02 -1.59E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.16E-01 -3.71E-02 -3.60E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.48E-02 1.44E-01 9.09E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.23E-02 -2.11E-01 -4.10E-01
Batten disease 5C56.1 Whole blood 2.24E-01 2.85E-02 1.59E-01
Behcet's disease 4A62 Peripheral blood 9.23E-01 -3.46E-02 -1.50E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.97E-01 -5.37E-02 -2.84E-01
Bladder cancer 2C94 Bladder tissue 3.45E-01 -5.80E-02 -3.06E-01
Breast cancer 2C60-2C6Z Breast tissue 5.03E-29 -5.01E-01 -1.15E+00
Cardioembolic stroke 8B11.20 Whole blood 7.79E-03 2.46E-01 6.69E-01
Cervical cancer 2C77 Cervical tissue 1.83E-04 -1.33E+00 -1.34E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.28E-01 -4.43E-02 -8.62E-02
Chronic hepatitis C 1E51.1 Whole blood 9.98E-01 1.12E-02 7.83E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 2.24E-02 -2.80E-01 -7.92E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.80E-01 1.80E-01 3.69E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.89E-03 4.68E-01 2.96E+00
Colon cancer 2B90 Colon tissue 5.24E-49 8.40E-01 1.69E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.06E-05 8.09E-01 7.32E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.44E-01 -2.64E-02 -6.90E-02
Endometriosis GA10 Endometrium tissue 9.69E-02 2.05E-01 6.04E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.50E-01 9.75E-02 5.22E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.03E-01 -2.45E-01 -6.70E-01
Gastric cancer 2B72 Gastric tissue 3.50E-01 4.62E-01 1.09E+00
Glioblastopma 2A00.00 Nervous tissue 7.25E-157 -1.30E+00 -2.37E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.63E-02 -3.41E-01 -8.14E-01
Head and neck cancer 2D42 Head and neck tissue 2.06E-05 -1.40E+00 -8.67E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.29E-02 1.54E-01 4.04E-01
Huntington's disease 8A01.10 Whole blood 9.03E-01 0.00E+00 0.00E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.37E-01 2.91E-02 6.10E-02
Immunodeficiency 4A00-4A20 Peripheral blood 6.71E-01 -9.30E-03 -6.32E-02
Influenza 1.00E+30 Whole blood 8.76E-01 -2.17E-02 -7.68E-02
Interstitial cystitis GC00.3 Bladder tissue 1.52E-03 1.06E+00 3.27E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.92E-02 -4.92E-01 -9.31E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.58E-02 4.81E-02 1.40E-01
Ischemic stroke 8B11 Peripheral blood 1.34E-01 1.47E-02 8.24E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.40E-01 1.98E-02 5.59E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 3.30E-01 6.19E-02 1.45E-01
Lateral sclerosis 8B60.4 Skin 3.28E-02 3.02E-01 2.03E+00
Liver cancer 2C12.0 Liver tissue 3.42E-12 -4.54E-01 -1.60E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.32E-04 6.04E-01 2.33E+00
Lung cancer 2C25 Lung tissue 4.31E-95 -1.14E+00 -2.85E+00
Lupus erythematosus 4A40 Whole blood 8.83E-02 -8.43E-02 -1.14E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.34E-01 2.06E-02 8.56E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.88E-01 1.57E-02 8.37E-02
Melanoma 2C30 Skin 2.02E-02 -6.65E-01 -6.65E-01
Multiple myeloma 2A83.1 Bone marrow 2.93E-01 1.20E-01 5.19E-01
Multiple myeloma 2A83.1 Peripheral blood 3.46E-02 -1.33E-01 -7.20E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.71E-01 1.32E-01 3.22E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.83E-07 3.32E-01 9.26E-01
Myelofibrosis 2A20.2 Whole blood 1.52E-03 3.96E-01 2.25E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.77E-01 7.17E-02 1.22E-01
Myopathy 8C70.6 Muscle tissue 9.76E-01 -3.42E-02 -1.16E-01
Neonatal sepsis KA60 Whole blood 2.84E-01 6.09E-02 1.79E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.27E-13 -1.94E+00 -7.07E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.86E-01 -1.31E-01 -4.19E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.73E-02 3.83E-01 1.33E+00
Olive pollen allergy CA08.00 Peripheral blood 2.34E-01 7.13E-02 9.05E-01
Oral cancer 2B6E Oral tissue 1.54E-05 -1.02E+00 -1.06E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.63E-01 9.56E-02 2.28E-01
Osteoporosis FB83.1 Bone marrow 1.42E-01 2.89E-01 9.24E-01
Ovarian cancer 2C73 Ovarian tissue 7.28E-02 2.83E-01 5.45E-01
Pancreatic cancer 2C10 Pancreas 5.65E-01 3.13E-03 8.32E-03
Parkinson's disease 8A00.0 Substantia nigra tissue 5.74E-02 1.40E-01 5.50E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.95E-02 1.33E-01 8.58E-01
Pituitary cancer 2D12 Pituitary tissue 6.27E-02 2.14E-01 5.20E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.42E-01 -3.45E-02 -8.06E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.37E-01 5.01E-03 3.20E-02
Polycythemia vera 2A20.4 Whole blood 5.85E-09 2.43E-01 1.25E+00
Pompe disease 5C51.3 Biceps muscle 9.72E-01 -9.69E-03 -4.18E-02
Preterm birth KA21.4Z Myometrium 5.59E-01 -2.33E-01 -1.00E+00
Prostate cancer 2C82 Prostate 2.44E-10 -7.70E-01 -2.27E+00
Psoriasis EA90 Skin 7.39E-21 4.89E-01 1.33E+00
Rectal cancer 2B92 Rectal colon tissue 6.63E-06 6.49E-01 3.25E+00
Renal cancer 2C90-2C91 Kidney 4.28E-04 -1.13E+00 -1.62E+00
Retinoblastoma 2D02.2 Uvea 1.03E-03 -6.09E-01 -1.76E+00
Rheumatoid arthritis FA20 Synovial tissue 3.99E-01 3.30E-01 7.05E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.67E-01 -1.01E-01 -1.99E-01
Schizophrenia 6A20 Prefrontal cortex 1.86E-01 -1.35E-01 -1.81E-01
Schizophrenia 6A20 Superior temporal cortex 9.88E-01 -4.04E-02 -1.80E-01
Scleroderma 4A42.Z Whole blood 1.38E-01 1.33E-01 8.82E-01
Seizure 8A60-8A6Z Whole blood 4.56E-01 -2.40E-03 -6.86E-03
Sensitive skin EK0Z Skin 5.57E-01 -3.06E-01 -6.43E-01
Sepsis with septic shock 1G41 Whole blood 9.11E-10 2.38E-01 6.47E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.60E-01 -2.29E-01 -8.92E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.13E-01 1.52E-01 5.28E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.19E-01 1.51E-01 6.55E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.94E-01 1.41E-01 1.01E+00
Skin cancer 2C30-2C3Z Skin 1.58E-82 -1.21E+00 -2.75E+00
Thrombocythemia 3B63 Whole blood 1.95E-03 1.83E-01 1.03E+00
Thrombocytopenia 3B64 Whole blood 3.02E-01 9.14E-02 3.91E-01
Thyroid cancer 2D10 Thyroid 7.83E-03 -3.35E-02 -1.08E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.09E-02 3.17E-01 8.38E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.81E-01 -2.17E-01 -8.86E-01
Type 2 diabetes 5A11 Liver tissue 6.57E-01 5.35E-02 2.17E-01
Ureter cancer 2C92 Urothelium 3.29E-01 -1.86E-01 -2.76E-01
Uterine cancer 2C78 Endometrium tissue 4.08E-04 -3.09E-01 -3.28E-01
Vitiligo ED63.0 Skin 3.64E-01 -2.86E-01 -6.99E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The ABCs of membrane transporters in health and disease (SLC series): Introduction. Molecular Aspects of Medicine, 2013, 34(2-3):95-107. (GeneName=SLC63A2)