Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT42EWA)

DTP Name Sodium-dependent phosphate transport protein 2A (SLC34A1)
Gene Name SLC34A1
UniProt ID
Q06495 (NPT2A_HUMAN)
VARIDT ID
DTD0284
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
FRTS2; HCINF2; NPHLOP1; NPT2; NPTIIa; Na(+)-dependent phosphate cotransporter 2A; Na(+)/Pi cotransporter 2A; NaPi-2a; NaPi-3; SLC11; SLC34A1; Sodium-phosphate transport protein 2A; Sodium/phosphate cotransporter 2A; Solute carrier family 34 member 1
DTP Family Phosphate:Na(+) Symporter (PNAS) Family ;
Tissue Specificity Kidney and lung.
Sequence
MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEH
TCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLKVPLMLTFLYLFVCSLDM
LSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLE
VSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAA
TGYLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATGDESLRNHS
LIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLPDLAVGLILLAGSLV
LLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSS
VFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQIALCHFFF
NISGILLWYPVPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQV
MVGVGTPFGALLAFVVLINVLQSRSPGHLPKWLQTWDFLPRWMHSLKPLDHLITRATLCC
ARPEPRSPPLPPRVFLEELPPATPSPRLALPAHHNATRL
Function This transporter involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Mediates 70-80% of the apical influx.
Endogenous Substrate(s) Na+
TCDB ID
2.A.58.1.5
Gene ID
6569
KEGG Pathway
( )
( )
Reactome Pathway
Defective SLC34A1 causes hypophosphatemic nephrolithiasis/osteoporosis 1 (NPHLOP1) (R-HSA-5619040 )
Surfactant metabolism (R-HSA-5683826 )
Type II Na+/Pi cotransporters (R-HSA-427589 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Clinical Trial Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Calcium phosphate DMGXCY9 Osteoporosis FB83.0 Phase 2 [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.40E-01 2.86E-02 1.76E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.33E-01 -2.47E-02 -1.14E-01
Alopecia ED70 Skin from scalp 2.37E-02 -2.16E-01 -7.40E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.83E-01 -1.14E-02 -8.53E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 8.21E-01 2.99E-02 4.06E-01
Aortic stenosis BB70 Calcified aortic valve 6.71E-01 -5.18E-02 -7.34E-02
Apnea 7A40 Hyperplastic tonsil 2.34E-02 1.17E-01 7.43E-01
Arthropathy FA00-FA5Z Peripheral blood 3.49E-01 3.62E-02 2.54E-01
Asthma CA23 Nasal and bronchial airway 7.12E-03 -8.69E-02 -2.98E-01
Atopic dermatitis EA80 Skin 1.09E-07 1.61E-01 2.55E+00
Autism 6A02 Whole blood 5.92E-01 -2.24E-02 -1.13E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.30E-02 -1.23E-01 -2.52E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.36E-01 1.78E-02 1.41E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.36E-03 9.68E-02 5.90E-01
Batten disease 5C56.1 Whole blood 9.06E-01 -2.52E-02 -4.67E-01
Behcet's disease 4A62 Peripheral blood 5.32E-01 -1.70E-02 -1.13E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.48E-01 6.48E-02 5.25E-01
Bladder cancer 2C94 Bladder tissue 1.89E-02 5.70E-01 1.70E+00
Breast cancer 2C60-2C6Z Breast tissue 9.96E-02 3.09E-02 1.65E-01
Cardioembolic stroke 8B11.20 Whole blood 1.51E-02 6.40E-02 4.85E-01
Cervical cancer 2C77 Cervical tissue 9.26E-01 -5.71E-03 -3.34E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.15E-01 -4.12E-02 -1.65E-01
Chronic hepatitis C 1E51.1 Whole blood 2.53E-01 4.29E-02 3.60E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.83E-01 -1.18E-03 -9.29E-03
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.04E-02 1.10E-01 6.27E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.35E-01 2.40E-02 3.13E-01
Colon cancer 2B90 Colon tissue 8.89E-17 -1.53E-01 -7.84E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.93E-01 -1.75E-01 -6.89E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.53E-01 -1.40E-01 -6.44E-01
Endometriosis GA10 Endometrium tissue 5.81E-01 -7.35E-03 -4.36E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.38E-01 5.79E-03 3.16E-02
Familial hypercholesterolemia 5C80.00 Whole blood 8.01E-02 -2.24E-01 -1.00E+00
Gastric cancer 2B72 Gastric tissue 8.52E-01 8.01E-02 3.67E-01
Glioblastopma 2A00.00 Nervous tissue 3.30E-30 -1.19E-01 -5.95E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.30E-02 -4.10E-01 -1.09E+00
Head and neck cancer 2D42 Head and neck tissue 3.85E-01 -6.22E-03 -4.05E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.66E-01 -2.57E-02 -1.86E-01
Huntington's disease 8A01.10 Whole blood 7.01E-01 -5.33E-02 -4.32E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.71E-01 -9.78E-02 -7.95E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.48E-02 1.68E-01 2.96E+00
Influenza 1.00E+30 Whole blood 3.59E-01 5.08E-02 2.37E-01
Interstitial cystitis GC00.3 Bladder tissue 9.93E-03 1.90E-01 2.70E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.09E-01 6.46E-02 2.74E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.43E-01 4.82E-03 1.81E-02
Ischemic stroke 8B11 Peripheral blood 5.73E-01 2.30E-02 1.81E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.24E-01 3.27E-02 1.63E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.46E-01 1.90E-01 1.09E+00
Lateral sclerosis 8B60.4 Skin 2.98E-01 7.18E-02 7.52E-01
Liver cancer 2C12.0 Liver tissue 8.74E-06 -2.28E-01 -8.98E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.63E-02 -7.38E-03 -4.77E-02
Lung cancer 2C25 Lung tissue 2.31E-01 -1.96E-02 -1.23E-01
Lupus erythematosus 4A40 Whole blood 3.59E-02 -1.40E-01 -4.13E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.30E-03 1.06E-01 5.12E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.95E-02 9.62E-02 8.72E-01
Melanoma 2C30 Skin 3.72E-01 -9.13E-03 -2.18E-02
Multiple myeloma 2A83.1 Bone marrow 1.25E-02 -1.90E-01 -8.63E-01
Multiple myeloma 2A83.1 Peripheral blood 4.19E-01 -1.35E-02 -7.17E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.62E-01 1.52E-01 5.35E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.80E-02 5.34E-02 5.71E-01
Myelofibrosis 2A20.2 Whole blood 8.78E-02 6.95E-02 5.17E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.25E-01 7.80E-02 2.85E-01
Myopathy 8C70.6 Muscle tissue 5.85E-02 -1.25E-01 -9.87E-01
Neonatal sepsis KA60 Whole blood 3.98E-01 2.29E-02 1.09E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.28E-01 -1.62E-01 -5.36E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.23E-01 -1.31E-01 -5.92E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.75E-01 1.26E-01 1.11E+00
Olive pollen allergy CA08.00 Peripheral blood 7.86E-01 1.17E-01 6.80E-01
Oral cancer 2B6E Oral tissue 1.01E-08 -2.60E-01 -1.73E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.02E-02 -3.07E-01 -1.01E+00
Osteoporosis FB83.1 Bone marrow 1.83E-01 1.77E-01 9.43E-01
Ovarian cancer 2C73 Ovarian tissue 9.34E-01 -2.18E-02 -1.09E-01
Pancreatic cancer 2C10 Pancreas 2.24E-03 -2.25E-01 -8.78E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.27E-01 -1.03E-01 -6.25E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.85E-01 -5.55E-02 -5.45E-01
Pituitary cancer 2D12 Pituitary tissue 1.50E-01 2.79E-02 1.17E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.24E-01 1.60E-01 6.38E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.62E-01 -1.07E-01 -4.90E-01
Polycythemia vera 2A20.4 Whole blood 1.20E-03 7.76E-02 7.70E-01
Pompe disease 5C51.3 Biceps muscle 6.59E-04 -1.64E-01 -2.44E+00
Preterm birth KA21.4Z Myometrium 3.21E-01 -3.68E-02 -3.01E-01
Prostate cancer 2C82 Prostate 1.25E-01 -1.66E-01 -4.26E-01
Psoriasis EA90 Skin 7.69E-01 1.79E-02 6.08E-02
Rectal cancer 2B92 Rectal colon tissue 9.16E-02 -1.46E-01 -8.88E-01
Renal cancer 2C90-2C91 Kidney 1.17E-03 -1.87E+00 -1.66E+00
Retinoblastoma 2D02.2 Uvea 3.06E-06 -3.66E-01 -2.43E+00
Rheumatoid arthritis FA20 Synovial tissue 4.78E-03 -4.52E-01 -1.65E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.03E-01 2.61E-02 2.27E-01
Schizophrenia 6A20 Prefrontal cortex 7.25E-01 4.49E-02 2.22E-01
Schizophrenia 6A20 Superior temporal cortex 2.05E-01 -3.45E-02 -2.93E-01
Scleroderma 4A42.Z Whole blood 1.63E-03 2.25E-01 1.48E+00
Seizure 8A60-8A6Z Whole blood 6.28E-01 3.28E-03 1.86E-02
Sensitive skin EK0Z Skin 5.43E-01 -1.85E-01 -9.81E-01
Sepsis with septic shock 1G41 Whole blood 1.24E-01 1.92E-02 8.50E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.85E-01 1.03E-01 4.23E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.53E-01 1.63E-01 7.92E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.44E-01 3.07E-02 4.15E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.30E-01 -6.81E-02 -6.21E-01
Skin cancer 2C30-2C3Z Skin 9.59E-02 -8.02E-02 -2.78E-01
Thrombocythemia 3B63 Whole blood 3.15E-01 3.05E-02 2.08E-01
Thrombocytopenia 3B64 Whole blood 9.95E-01 -5.86E-02 -2.99E-01
Thyroid cancer 2D10 Thyroid 4.58E-04 5.38E-02 2.66E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.41E-06 -3.36E-01 -1.98E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.74E-01 -2.58E-02 -3.69E-01
Type 2 diabetes 5A11 Liver tissue 2.08E-01 -1.43E-01 -1.20E+00
Ureter cancer 2C92 Urothelium 3.61E-01 -2.12E-02 -1.30E-01
Uterine cancer 2C78 Endometrium tissue 2.67E-01 -2.97E-02 -1.28E-01
Vitiligo ED63.0 Skin 5.51E-01 2.30E-02 2.29E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Phosphate transporters and their function. Annu Rev Physiol. 2013;75:535-50.