Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT4827A)

DTP Name Glucose transporter type 4, insulin-responsive (SLC2A4)
Gene Name SLC2A4
UniProt ID
P14672 (GLUT4_HUMAN)
VARIDT ID
DTD0262
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms GLUT-4; GLUT4; SLC2A4; Solute carrier family 2, facilitated glucose transporter member 4
DTP Family Major Facilitator Superfamily (MFS)
Sugar Porter (SP) Family
Tissue Specificity Skeletal and cardiac muscles; brown and whitefat.
Sequence
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND
Function This insulin-regulated transporter facilitates glucose transport.
Endogenous Substrate(s) Glucose
TCDB ID
2.A.1.1.80
Gene ID
6517
KEGG Pathway
FoxO signaling pathway (hsa04068 )
AMPK signaling pathway (hsa04152 )
Insulin signaling pathway (hsa04910 )
Adipocytokine signaling pathway (hsa04920 )
Type II diabetes mellitus (hsa04930 )
Insulin resistance (hsa04931 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Cellular hexose transport (R-HSA-189200 )
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
Translocation of SLC2A4 (GLUT4) to the plasma membrane (R-HSA-1445148 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
2-deoxyglucose DMIAHVU Solid tumour/cancer 2A00-2F9Z Approved [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.98E-02 6.99E-02 3.16E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.20E-01 4.51E-02 2.15E-01
Alopecia ED70 Skin from scalp 6.41E-01 -1.31E-03 -3.53E-03
Alzheimer's disease 8A20 Entorhinal cortex 4.14E-01 6.68E-03 3.91E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 2.62E-01 1.43E-02 1.83E-01
Aortic stenosis BB70 Calcified aortic valve 9.66E-01 8.37E-03 5.99E-02
Apnea 7A40 Hyperplastic tonsil 1.13E-01 5.55E-02 6.54E-01
Arthropathy FA00-FA5Z Peripheral blood 6.53E-01 2.24E-02 1.34E-01
Asthma CA23 Nasal and bronchial airway 6.39E-01 2.30E-02 1.05E-01
Atopic dermatitis EA80 Skin 7.18E-01 -2.30E-02 -1.58E-01
Autism 6A02 Whole blood 1.19E-01 -1.09E-01 -6.53E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.98E-01 -1.76E-01 -1.58E+00
Autosomal dominant monocytopenia 4B04 Whole blood 9.22E-01 1.72E-02 1.77E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.41E-02 4.57E-02 2.51E-01
Batten disease 5C56.1 Whole blood 3.75E-01 5.93E-02 2.99E-01
Behcet's disease 4A62 Peripheral blood 3.14E-01 -1.66E-02 -5.98E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.31E-01 -7.72E-02 -4.79E-01
Bladder cancer 2C94 Bladder tissue 5.70E-04 2.62E-01 2.36E+00
Breast cancer 2C60-2C6Z Breast tissue 1.39E-17 -1.38E-01 -4.83E-01
Cardioembolic stroke 8B11.20 Whole blood 7.40E-01 4.72E-03 2.02E-02
Cervical cancer 2C77 Cervical tissue 1.22E-02 -8.10E-02 -4.44E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.21E-01 -3.94E-02 -1.58E-01
Chronic hepatitis C 1E51.1 Whole blood 3.58E-02 -7.93E-02 -5.48E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.10E-01 2.36E-02 1.65E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.92E-03 1.18E-01 5.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.36E-01 5.59E-04 3.46E-03
Colon cancer 2B90 Colon tissue 2.77E-09 -1.34E-01 -5.97E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.00E-01 -1.66E-02 -9.63E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.93E-01 -9.65E-03 -7.02E-02
Endometriosis GA10 Endometrium tissue 8.50E-01 -1.46E-02 -4.82E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.87E-01 1.56E-02 1.55E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.24E-01 -1.75E-02 -6.26E-02
Gastric cancer 2B72 Gastric tissue 2.76E-02 -3.41E-01 -3.11E+00
Glioblastopma 2A00.00 Nervous tissue 5.93E-38 -2.60E-01 -8.58E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.08E-03 -1.55E-01 -1.61E+00
Head and neck cancer 2D42 Head and neck tissue 1.50E-04 -8.27E-02 -4.73E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.89E-01 1.39E-02 8.77E-02
Huntington's disease 8A01.10 Whole blood 8.08E-01 -3.37E-02 -2.18E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.76E-01 -1.99E-01 -8.15E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.70E-01 -5.07E-02 -6.93E-01
Influenza 1.00E+30 Whole blood 8.60E-01 2.24E-03 2.40E-02
Interstitial cystitis GC00.3 Bladder tissue 3.86E-01 -2.01E-02 -1.20E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.07E-01 1.82E-02 7.76E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.59E-01 5.94E-02 2.37E-01
Ischemic stroke 8B11 Peripheral blood 2.24E-01 9.15E-02 6.29E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.32E-01 9.10E-03 3.68E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 4.96E-01 2.35E-01 8.67E-01
Lateral sclerosis 8B60.4 Skin 8.13E-02 1.90E-01 1.32E+00
Liver cancer 2C12.0 Liver tissue 4.15E-06 -3.19E-01 -1.04E+00
Liver failure DB99.7-DB99.8 Liver tissue 5.91E-01 -1.07E-01 -5.82E-01
Lung cancer 2C25 Lung tissue 2.73E-02 1.76E-02 1.07E-01
Lupus erythematosus 4A40 Whole blood 8.10E-04 -1.75E-01 -5.41E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.21E-01 5.02E-02 2.20E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.09E-01 6.04E-02 3.52E-01
Melanoma 2C30 Skin 1.97E-01 -1.79E-01 -4.45E-01
Multiple myeloma 2A83.1 Bone marrow 9.58E-01 -1.97E-02 -1.15E-01
Multiple myeloma 2A83.1 Peripheral blood 8.54E-01 1.33E-02 9.74E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.32E-01 0.00E+00 0.00E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.45E-04 -1.41E-01 -1.13E+00
Myelofibrosis 2A20.2 Whole blood 1.08E-03 4.24E-01 2.42E+00
Myocardial infarction BA41-BA50 Peripheral blood 8.73E-01 3.77E-02 1.10E-01
Myopathy 8C70.6 Muscle tissue 4.60E-01 -3.88E-01 -6.07E-01
Neonatal sepsis KA60 Whole blood 8.88E-02 -3.37E-02 -1.49E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.58E-03 -5.11E-01 -1.51E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.77E-01 -2.95E-01 -9.56E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.96E-01 5.74E-02 4.59E-01
Olive pollen allergy CA08.00 Peripheral blood 2.20E-01 4.27E-02 4.86E-01
Oral cancer 2B6E Oral tissue 3.72E-06 -3.81E-01 -1.10E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.34E-01 -3.21E-01 -7.57E-01
Osteoporosis FB83.1 Bone marrow 6.33E-02 1.84E-01 1.33E+00
Ovarian cancer 2C73 Ovarian tissue 3.14E-02 -3.70E-01 -1.05E+00
Pancreatic cancer 2C10 Pancreas 6.24E-01 -3.00E-02 -1.48E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.59E-01 -9.39E-02 -5.65E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.01E-01 2.00E-02 1.32E-01
Pituitary cancer 2D12 Pituitary tissue 1.02E-02 3.42E-01 1.39E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.05E-03 3.27E-01 2.29E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.12E-01 -9.72E-03 -3.11E-02
Polycythemia vera 2A20.4 Whole blood 9.37E-10 3.02E-01 1.69E+00
Pompe disease 5C51.3 Biceps muscle 1.49E-02 -1.36E+00 -2.73E+00
Preterm birth KA21.4Z Myometrium 3.24E-01 -1.88E-01 -1.02E+00
Prostate cancer 2C82 Prostate 1.73E-01 8.48E-02 2.19E-01
Psoriasis EA90 Skin 8.65E-05 -2.58E-01 -8.23E-01
Rectal cancer 2B92 Rectal colon tissue 1.63E-01 -1.60E-01 -9.47E-01
Renal cancer 2C90-2C91 Kidney 2.81E-02 -2.97E-01 -7.50E-01
Retinoblastoma 2D02.2 Uvea 1.98E-02 1.23E-01 9.38E-01
Rheumatoid arthritis FA20 Synovial tissue 2.45E-01 -2.19E-01 -4.96E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.49E-01 1.90E-02 1.40E-01
Schizophrenia 6A20 Prefrontal cortex 1.57E-01 3.34E-02 1.61E-01
Schizophrenia 6A20 Superior temporal cortex 9.33E-01 2.20E-02 1.61E-01
Scleroderma 4A42.Z Whole blood 9.61E-02 1.04E-01 6.56E-01
Seizure 8A60-8A6Z Whole blood 3.41E-01 -1.57E-01 -5.20E-01
Sensitive skin EK0Z Skin 6.35E-02 -9.34E-02 -7.96E-01
Sepsis with septic shock 1G41 Whole blood 7.45E-02 -2.26E-02 -9.37E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.48E-01 1.36E-01 3.80E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.47E-01 1.92E-01 7.15E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.26E-01 -4.06E-01 -8.20E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.36E-01 -3.40E-01 -1.40E+00
Skin cancer 2C30-2C3Z Skin 3.42E-09 -2.18E-01 -6.71E-01
Thrombocythemia 3B63 Whole blood 9.65E-05 2.12E-01 1.16E+00
Thrombocytopenia 3B64 Whole blood 6.97E-01 1.54E-01 5.99E-01
Thyroid cancer 2D10 Thyroid 9.29E-07 6.59E-02 3.81E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.53E-03 -1.18E+00 -1.32E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.44E-02 8.92E-02 1.99E+00
Type 2 diabetes 5A11 Liver tissue 3.68E-01 -6.20E-02 -7.33E-01
Ureter cancer 2C92 Urothelium 5.98E-01 3.09E-02 1.74E-01
Uterine cancer 2C78 Endometrium tissue 4.00E-09 -2.15E-01 -7.23E-01
Vitiligo ED63.0 Skin 5.05E-01 1.36E-01 6.01E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Glucose transporter type 4 (SLC2A4) DTT Info
DTP DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
DS-1150b DM029TQ Type-2 diabetes 5A11 Phase 1 [1]
------------------------------------------------------------------------------------

References

1 Sanford-Burnham goes fourth. SciBX 7(22); doi:10.1038/scibx.2014.633. June 5 2014
2 Need for GLUT4 activation to reach maximum effect of insulin-mediated glucose uptake in brown adipocytes isolated from GLUT4myc-expressing mice. Diabetes. 2002 Sep;51(9):2719-26.