General Information of Drug Transporter (DTP) (ID: DT4JZLA)

DTP Name Sodium/hydrogen exchanger 9B2 (SLC9B2)
Gene Name SLC9B2
UniProt ID
Q86UD5 (SL9B2_HUMAN)
VARIDT ID
DTD0496
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
NHA2; NHE domain-containing protein 2; NHE10; NHEDC2; Na(+)/H(+) exchanger NHA2; Na(+)/H(+) exchanger-like domain-containing protein 2; SLC9B2; Sodium/hydrogen exchanger-like domain-containing protein 2; Solute carrier family 9 subfamily B member 2
DTP Family Monovalent Cation:Proton Antiporter-1 (CPA1) family ;
Tissue Specificity Widely expressed (PubMed:18508966). Highlevels detected in the distal tubules of the kidney nephron(PubMed:18508966). Detected in red blood cells (at protein level)(PubMed:18000046, PubMed:18508966).
Sequence
MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQ
ETPTEANHVQRLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIII
LFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIA
LSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHYLLGLPWQWGFILGFV
LGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV
FNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFP
GSGGLCTLVMAFLAGMGWTSEKAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGL
CVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGE
KQLEDYGMDVLTVAFLSILITAPIGSLLIGLLGPRLLQKVEHQNKDEEVQGETSVQV
Function This transporter is Na(+)/H(+) antiporter that extrudes Na(+) or Li(+) in exchange for external protons across the membrane.
Endogenous Substrate(s) Na+; Li+; H+
TCDB ID
2.A.36.2.2
Gene ID
133308
Reactome Pathway
Stimuli-sensing channels (R-HSA-2672351 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.28E-13 4.07E-01 1.16E+00
Adrenocortical carcinoma 2D11.Z Kidney 7.48E-01 1.32E-02 3.32E-02
Alopecia ED70 Skin from scalp 1.74E-03 1.13E-01 5.05E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.03E-02 -2.18E-01 -5.43E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.56E-01 -4.46E-03 -1.29E-02
Aortic stenosis BB70 Calcified aortic valve 7.69E-01 3.36E-02 9.80E-02
Apnea 7A40 Hyperplastic tonsil 3.00E-01 -2.03E-01 -7.34E-01
Arthropathy FA00-FA5Z Peripheral blood 1.10E-01 -1.09E-01 -4.99E-01
Asthma CA23 Nasal and bronchial airway 4.85E-08 3.25E-01 6.11E-01
Atopic dermatitis EA80 Skin 9.33E-01 -4.22E-02 -2.26E-01
Autism 6A02 Whole blood 1.28E-01 -8.40E-03 -3.23E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.35E-01 -2.42E-01 -1.53E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.61E-01 -3.95E-02 -2.38E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.66E-03 1.28E-01 4.45E-01
Batten disease 5C56.1 Whole blood 6.22E-01 -9.55E-02 -4.67E-01
Behcet's disease 4A62 Peripheral blood 2.67E-01 -1.31E-01 -5.34E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.12E-01 1.05E-01 3.29E-01
Bladder cancer 2C94 Bladder tissue 1.19E-01 -1.96E-01 -6.98E-01
Breast cancer 2C60-2C6Z Breast tissue 9.28E-21 -3.04E-01 -1.06E+00
Cardioembolic stroke 8B11.20 Whole blood 6.24E-01 -2.47E-02 -7.72E-02
Cervical cancer 2C77 Cervical tissue 1.19E-01 -6.06E-02 -2.43E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.23E-01 -8.23E-02 -1.86E-01
Chronic hepatitis C 1E51.1 Whole blood 2.01E-01 -1.41E-01 -5.85E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.40E-02 1.62E-01 5.78E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.99E-02 -6.95E-02 -4.00E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.26E-01 -2.41E-01 -5.43E-01
Colon cancer 2B90 Colon tissue 4.02E-90 8.07E-01 2.92E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.26E-02 3.66E-01 1.42E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.17E-01 1.93E-02 4.47E-02
Endometriosis GA10 Endometrium tissue 4.60E-01 2.38E-01 4.29E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.43E-01 -4.74E-02 -2.43E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.56E-12 -6.72E-01 -1.88E+00
Gastric cancer 2B72 Gastric tissue 2.37E-01 3.40E-01 8.97E-01
Glioblastopma 2A00.00 Nervous tissue 1.16E-46 -4.17E-01 -8.63E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.37E-02 3.00E-01 5.79E-01
Head and neck cancer 2D42 Head and neck tissue 1.80E-17 4.09E-01 1.46E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.13E-01 -2.41E-02 -6.63E-02
Huntington's disease 8A01.10 Whole blood 6.40E-02 -1.09E-01 -9.65E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.87E-01 1.78E-01 3.09E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.87E-01 2.53E-02 3.27E-01
Influenza 1.00E+30 Whole blood 4.09E-01 -1.05E+00 -1.31E+00
Interstitial cystitis GC00.3 Bladder tissue 1.31E-02 5.96E-01 2.20E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.76E-01 5.43E-02 1.22E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.65E-03 1.72E-01 4.82E-01
Ischemic stroke 8B11 Peripheral blood 6.01E-01 -8.52E-02 -3.35E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.15E-01 1.68E-02 4.99E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 1.24E-01 -6.01E-01 -1.03E+00
Lateral sclerosis 8B60.4 Skin 7.06E-01 2.12E-01 6.67E-01
Liver cancer 2C12.0 Liver tissue 3.23E-22 -1.10E+00 -2.47E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.82E-05 -2.12E+00 -5.64E+00
Lung cancer 2C25 Lung tissue 8.36E-17 1.97E-01 5.86E-01
Lupus erythematosus 4A40 Whole blood 3.34E-02 1.13E-01 2.11E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.36E-02 -4.90E-02 -2.12E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.33E-01 2.23E-02 7.26E-02
Melanoma 2C30 Skin 2.40E-01 3.60E-01 4.20E-01
Multiple myeloma 2A83.1 Bone marrow 6.53E-08 7.80E-01 6.07E+00
Multiple myeloma 2A83.1 Peripheral blood 5.34E-01 -1.06E-01 -3.18E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.56E-01 -7.58E-02 -1.45E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.93E-02 1.19E-01 2.84E-01
Myelofibrosis 2A20.2 Whole blood 5.88E-01 1.22E-02 9.96E-02
Myocardial infarction BA41-BA50 Peripheral blood 3.74E-02 -4.93E-01 -4.78E-01
Myopathy 8C70.6 Muscle tissue 5.49E-01 4.71E-01 7.32E-01
Neonatal sepsis KA60 Whole blood 1.56E-07 -2.89E-01 -9.76E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.60E-04 -3.77E-01 -1.15E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.26E-01 3.29E-01 7.80E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.53E-01 -1.06E-01 -3.93E-01
Olive pollen allergy CA08.00 Peripheral blood 4.35E-01 -6.44E-01 -8.89E-01
Oral cancer 2B6E Oral tissue 5.93E-01 1.40E-01 4.62E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.57E-01 5.49E-01 6.15E-01
Osteoporosis FB83.1 Bone marrow 6.49E-02 -2.33E-01 -1.56E+00
Ovarian cancer 2C73 Ovarian tissue 4.95E-04 -7.39E-01 -1.99E+00
Pancreatic cancer 2C10 Pancreas 2.50E-01 1.72E-01 2.95E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.68E-01 -1.20E-01 -2.42E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.83E-01 -7.05E-02 -4.26E-01
Pituitary cancer 2D12 Pituitary tissue 5.88E-02 1.69E-01 3.56E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.03E-02 2.88E-01 8.07E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.88E-01 -2.70E-02 -1.96E-01
Polycythemia vera 2A20.4 Whole blood 8.56E-07 -1.91E-01 -1.18E+00
Pompe disease 5C51.3 Biceps muscle 1.25E-03 5.53E-01 2.71E+00
Preterm birth KA21.4Z Myometrium 2.51E-01 -3.17E-01 -8.53E-01
Prostate cancer 2C82 Prostate 6.46E-02 8.05E-01 9.34E-01
Psoriasis EA90 Skin 9.51E-09 1.22E-01 3.58E-01
Rectal cancer 2B92 Rectal colon tissue 6.93E-10 5.18E-01 5.79E+00
Renal cancer 2C90-2C91 Kidney 2.56E-05 4.53E-01 1.48E+00
Retinoblastoma 2D02.2 Uvea 2.51E-01 -3.31E-02 -7.21E-02
Rheumatoid arthritis FA20 Synovial tissue 7.50E-04 7.13E-01 1.89E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.32E-01 -1.12E-02 -9.40E-02
Schizophrenia 6A20 Prefrontal cortex 4.76E-02 -1.42E-01 -2.57E-01
Schizophrenia 6A20 Superior temporal cortex 3.78E-01 -1.20E-02 -4.38E-02
Scleroderma 4A42.Z Whole blood 6.16E-02 -1.23E-01 -5.53E-01
Seizure 8A60-8A6Z Whole blood 9.86E-01 5.57E-02 1.76E-01
Sensitive skin EK0Z Skin 8.44E-01 4.03E-02 3.46E-01
Sepsis with septic shock 1G41 Whole blood 2.84E-17 -1.99E-01 -8.47E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.24E-01 -4.49E-02 -3.05E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.48E-02 -7.12E-02 -2.99E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.45E-01 1.12E-02 5.66E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.24E-01 3.60E-01 1.78E+00
Skin cancer 2C30-2C3Z Skin 1.21E-36 6.96E-01 1.58E+00
Thrombocythemia 3B63 Whole blood 2.40E-02 -3.95E-02 -2.79E-01
Thrombocytopenia 3B64 Whole blood 7.87E-01 5.52E-02 1.30E-01
Thyroid cancer 2D10 Thyroid 2.44E-05 9.92E-02 3.42E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.20E-09 6.62E-01 3.33E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.66E-03 -7.30E-01 -3.31E+00
Type 2 diabetes 5A11 Liver tissue 1.18E-01 3.86E-01 1.09E+00
Ureter cancer 2C92 Urothelium 2.54E-01 7.89E-02 3.68E-01
Uterine cancer 2C78 Endometrium tissue 4.97E-22 -4.70E-01 -1.58E+00
Vitiligo ED63.0 Skin 3.78E-01 -8.25E-02 -3.52E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases