Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT4MBHD)

DTP Name Adrenoleukodystrophy-like 1 (ABCD2)
Gene Name ABCD2
UniProt ID
Q9UBJ2 (ABCD2_HUMAN)
VARIDT ID
DTD0064
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABC39; ABCD2; ALD1; ALDL1; ALDR; ALDRP; ATP-binding cassette sub-family D member 2; Adrenoleukodystrophy-related protein; hALDR
DTP Family ATP-Binding Cassette (ABC) Superfamily ;
Tissue Specificity Predominantly expressed in brain and heart.
Sequence
MTHMLNAAADRVKWTRSSAAKRAACLVAAAYALKTLYPIIGKRLKQSGHGKKKAAAYPAA
ENTEILHCTETICEKPSPGVNADFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFL
SIYVAGLDGKIVKSIVEKKPRTFIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLV
DHAYETYFTNQTYYKVINMDGRLANPDQSLTEDIMMFSQSVAHLYSNLTKPILDVMLTSY
TLIQTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGKLVAEEAHRKGYLRYVHSRII
ANVEEIAFYRGHKVEMKQLQKSYKALADQMNLILSKRLWYIMIEQFLMKYVWSSSGLIMV
AIPIITATGFADGEDGQKQVMVSERTEAFTTARNLLASGADAIERIMSSYKEVTELAGYT
ARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSDTLAIKGKVIDVDHGIIC
ENVPIITPAGEVVASRLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYEGVLYKPPP
QHMFYIPQRPYMSLGSLRDQVIYPDSVDDMHDKGYTDQDLERILHNVHLYHIVQREGGWD
AVMDWKDVLSGGEKQRMGMARMFYHKPKYALLDECTSAVSIDVEGKIFQAAKGAGISLLS
ITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNEL
CKILGEDSVLKTIKNEDETS
Function Act as a fatty acids transporter.
Endogenous Substrate(s) Fatty acids
TCDB ID
3.A.1.203.7
Gene ID
225
KEGG Pathway
ABC transporters (hsa02010 )
Peroxisome (hsa04146 )
Reactome Pathway
Class I peroxisomal membrane protein import (R-HSA-9603798 )
ABC transporters in lipid homeostasis (R-HSA-1369062 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.28E-02 -1.81E-02 -1.32E-01
Adrenocortical carcinoma 2D11.Z Kidney 5.54E-03 8.65E-02 5.59E-01
Alopecia ED70 Skin from scalp 1.49E-04 2.07E-01 5.54E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.67E-07 -4.57E-01 -8.80E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.61E-01 -2.22E-02 -1.79E-01
Aortic stenosis BB70 Calcified aortic valve 7.17E-01 -8.30E-02 -2.27E-01
Apnea 7A40 Hyperplastic tonsil 2.80E-01 -1.55E-02 -1.04E-01
Arthropathy FA00-FA5Z Peripheral blood 9.53E-02 -2.20E-01 -4.78E-01
Asthma CA23 Nasal and bronchial airway 1.29E-02 -1.93E-01 -3.75E-01
Atopic dermatitis EA80 Skin 1.26E-01 -4.68E-02 -1.62E-01
Autism 6A02 Whole blood 6.14E-01 0.00E+00 0.00E+00
Autoimmune uveitis 9A96 Peripheral monocyte 4.03E-01 -3.41E-02 -5.34E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.30E-02 -2.32E-01 -1.94E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.93E-09 1.24E-01 8.45E-01
Batten disease 5C56.1 Whole blood 1.42E-01 -1.64E-01 -5.36E-01
Behcet's disease 4A62 Peripheral blood 8.07E-01 -2.06E-02 -6.59E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.88E-01 -2.69E-02 -8.40E-02
Bladder cancer 2C94 Bladder tissue 9.79E-02 1.35E-01 7.57E-01
Breast cancer 2C60-2C6Z Breast tissue 4.81E-39 -7.08E-01 -5.84E-01
Cardioembolic stroke 8B11.20 Whole blood 5.00E-02 -2.58E-01 -4.44E-01
Cervical cancer 2C77 Cervical tissue 6.60E-01 -5.07E-02 -2.69E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.57E-01 -1.02E-01 -1.52E-01
Chronic hepatitis C 1E51.1 Whole blood 8.40E-02 -2.26E-01 -8.87E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.52E-02 6.08E-02 5.97E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.20E-04 -1.50E-01 -3.62E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.16E-01 -9.45E-02 -3.99E-01
Colon cancer 2B90 Colon tissue 1.65E-08 -9.91E-02 -5.53E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.15E-01 -1.00E-01 -5.64E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.17E-01 3.91E-02 4.68E-01
Endometriosis GA10 Endometrium tissue 9.35E-01 5.91E-03 4.33E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.76E-01 8.10E-03 2.81E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.98E-10 -4.58E-01 -1.50E+00
Gastric cancer 2B72 Gastric tissue 3.51E-01 -2.00E-02 -2.91E-01
Glioblastopma 2A00.00 Nervous tissue 1.07E-25 -4.56E-01 -7.40E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.31E-01 -1.90E-01 -1.51E+00
Head and neck cancer 2D42 Head and neck tissue 5.45E-09 -1.93E-01 -4.20E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.30E-02 -1.81E-01 -4.83E-01
Huntington's disease 8A01.10 Whole blood 2.17E-01 -6.14E-02 -6.38E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.87E-01 1.62E-01 1.04E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.00E-02 -1.39E-01 -6.23E-01
Influenza 1.00E+30 Whole blood 1.34E-01 2.48E-01 1.45E+00
Interstitial cystitis GC00.3 Bladder tissue 1.06E-02 2.81E-01 1.62E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.01E-02 -1.22E-01 -6.48E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.44E-03 1.84E-01 4.44E-01
Ischemic stroke 8B11 Peripheral blood 3.10E-01 -2.52E-01 -5.31E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.48E-02 -3.23E-01 -5.46E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.24E-01 1.39E-02 7.28E-02
Lateral sclerosis 8B60.4 Skin 4.22E-01 3.62E-02 4.36E-01
Liver cancer 2C12.0 Liver tissue 4.70E-01 -1.84E-02 -1.27E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.70E-01 -6.93E-02 -9.51E-01
Lung cancer 2C25 Lung tissue 1.98E-02 -3.34E-02 -1.72E-01
Lupus erythematosus 4A40 Whole blood 9.76E-01 3.39E-01 3.17E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.78E-03 -3.71E-01 -5.88E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.16E-01 2.11E-03 6.90E-03
Melanoma 2C30 Skin 4.43E-01 4.75E-02 7.58E-02
Multiple myeloma 2A83.1 Bone marrow 4.49E-01 2.63E-02 1.13E-01
Multiple myeloma 2A83.1 Peripheral blood 3.94E-01 2.65E-02 6.45E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.88E-01 -1.28E-01 -2.75E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.91E-01 4.85E-03 8.47E-02
Myelofibrosis 2A20.2 Whole blood 8.75E-03 -2.23E-01 -1.02E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.64E-03 -5.26E-01 -4.59E-01
Myopathy 8C70.6 Muscle tissue 1.00E-01 -1.35E-02 -1.08E-01
Neonatal sepsis KA60 Whole blood 5.86E-10 -3.39E-01 -7.28E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.08E-01 -3.79E-01 -1.87E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.46E-01 1.53E-02 1.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.10E-02 4.30E-01 1.33E+00
Olive pollen allergy CA08.00 Peripheral blood 8.81E-01 1.21E-02 7.69E-02
Oral cancer 2B6E Oral tissue 5.87E-03 -1.42E-01 -9.30E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.00E-01 -4.77E-02 -2.37E-01
Osteoporosis FB83.1 Bone marrow 2.11E-01 1.12E-01 8.02E-01
Ovarian cancer 2C73 Ovarian tissue 2.49E-01 -4.95E-02 -2.90E-01
Pancreatic cancer 2C10 Pancreas 2.84E-01 -7.35E-02 -2.90E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.05E-01 -1.26E-01 -7.24E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.59E-01 -5.96E-03 -1.49E-02
Pituitary cancer 2D12 Pituitary tissue 2.07E-02 2.05E-01 1.06E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.19E-04 3.88E-01 1.45E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.99E-01 -2.22E-03 -1.12E-02
Polycythemia vera 2A20.4 Whole blood 1.01E-05 -1.94E-01 -8.76E-01
Pompe disease 5C51.3 Biceps muscle 5.97E-03 -2.16E-01 -2.53E+00
Preterm birth KA21.4Z Myometrium 3.39E-01 2.73E-02 5.53E-02
Prostate cancer 2C82 Prostate 4.74E-01 -5.37E-02 -1.21E-01
Psoriasis EA90 Skin 6.38E-02 -6.29E-02 -1.78E-01
Rectal cancer 2B92 Rectal colon tissue 1.30E-01 -2.00E-01 -1.15E+00
Renal cancer 2C90-2C91 Kidney 1.74E-01 -3.35E-02 -3.82E-01
Retinoblastoma 2D02.2 Uvea 1.76E-06 -1.54E+00 -2.75E+00
Rheumatoid arthritis FA20 Synovial tissue 2.23E-01 2.36E-02 8.58E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.89E-01 -1.94E-02 -8.04E-02
Schizophrenia 6A20 Prefrontal cortex 9.05E-02 -5.09E-02 -1.59E-01
Schizophrenia 6A20 Superior temporal cortex 3.06E-01 -7.68E-02 -5.31E-01
Scleroderma 4A42.Z Whole blood 3.17E-02 -2.98E-01 -1.10E+00
Seizure 8A60-8A6Z Whole blood 1.33E-01 1.13E-01 3.13E-01
Sensitive skin EK0Z Skin 9.33E-01 3.52E-02 4.18E-01
Sepsis with septic shock 1G41 Whole blood 1.40E-29 -5.16E-01 -1.09E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.49E-01 1.43E-01 2.14E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.95E-02 -1.61E-01 -9.94E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.27E-01 -4.25E-01 -2.64E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.96E-02 8.89E-02 1.41E+00
Skin cancer 2C30-2C3Z Skin 6.81E-01 3.42E-02 8.35E-02
Thrombocythemia 3B63 Whole blood 4.37E-02 -1.07E-01 -4.81E-01
Thrombocytopenia 3B64 Whole blood 5.67E-01 1.33E-01 1.38E-01
Thyroid cancer 2D10 Thyroid 6.48E-01 3.61E-02 1.31E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.94E-01 2.00E-02 1.52E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.30E-02 -8.43E-01 -2.41E+00
Type 2 diabetes 5A11 Liver tissue 8.87E-01 5.00E-02 2.88E-01
Ureter cancer 2C92 Urothelium 3.23E-01 -5.66E-02 -5.98E-01
Uterine cancer 2C78 Endometrium tissue 8.01E-01 -1.71E-02 -7.95E-02
Vitiligo ED63.0 Skin 7.84E-01 3.66E-02 5.01E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases