Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT4X2AH)

DTP Name Anion exchange protein 3 (SLC4A3)
Gene Name SLC4A3
UniProt ID
P48751 (B3A3_HUMAN)
VARIDT ID
DTD0384
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms AE 3; AE3; Anion exchanger 3; CAE3/BAE3; Cardiac/brain band 3-like protein; Neuronal band 3-like protein; SLC2C; SLC4A3; Solute carrier family 4 member 3
DTP Family Anion Exchanger (AE) Family ;
Tissue Specificity Both BAE3 and CAE3 are expressed in failingventricle.
Sequence
MANGVIPPPGGASPLPQVRVPLEEPPLSPDVEEEDDDLGKTLAVSRFGDLISKPPAWDPE
KPSRSYSERDFEFHRHTSHHTHHPLSARLPPPHKLRRLPPTSARHTRRKRKKEKTSAPPS
EGTPPIQEEGGAGVDEEEEEEEEEEGESEAEPVEPPHSGTPQKAKFSIGSDEDDSPGLPG
RAAVTKPLPSVGPHTDKSPQHSSSSPSPRARASRLAGEKSRPWSPSASYDLRERLCPGSA
LGNPGGPEQQVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSRTQGGRGSPSG
LAPILRRKKKKKKLDRRPHEVFVELNELMLDRSQEPHWRETARWIKFEEDVEEETERWGK
PHVASLSFRSLLELRRTIAHGAALLDLEQTTLPGIAHLVVETMIVSDQIRPEDRASVLRT
LLLKHSHPNDDKDSGFFPRNPSSSSMNSVLGNHHPTPSHGPDGAVPTMADDLGEPAPLWP
HDPDAKEKPLHMPGGDGHRGKSLKLLEKIPEDAEATVVLVGCVPFLEQPAAAFVRLNEAV
LLESVLEVPVPVRFLFVMLGPSHTSTDYHELGRSIATLMSDKLFHEAAYQADDRQDLLSA
ISEFLDGSIVIPPSEVEGRDLLRSVAAFQRELLRKRREREQTKVEMTTRGGYTAPGKELS
LELGGSEATPEDDPLLRTGSVFGGLVRDVRRRYPHYPSDLRDALHSQCVAAVLFIYFAAL
SPAITFGGLLGEKTEGLMGVSELIVSTAVLGVLFSLLGAQPLLVVGFSGPLLVFEEAFFK
FCRAQDLEYLTGRVWVGLWLVVFVLALVAAEGSFLVRYISPFTQEIFAFLISLIFIYETF
YKLYKVFTEHPLLPFYPPEGALEGSLDAGLEPNGSALPPTEGPPSPRNQPNTALLSLILM
LGTFFIAFFLRKFRNSRFLGGKARRIIGDFGIPISILVMVLVDYSITDTYTQKLTVPTGL
SVTSPDKRSWFIPPLGSARPFPPWMMVAAAVPALLVLILIFMETQITALIVSQKARRLLK
GSGFHLDLLLIGSLGGLCGLFGLPWLTAATVRSVTHVNALTVMRTAIAPGDKPQIQEVRE
QRVTGVLIASLVGLSIVMGAVLRRIPLAVLFGIFLYMGVTSLSGIQLSQRLLLILMPAKH
HPEQPYVTKVKTWRMHLFTCIQLGCIALLWVVKSTAASLAFPFLLLLTVPLRHCLLPRLF
QDRELQALDSEDAEPNFDEDGQDEYNELHMPV
Function This transporter is a plasma membrane anion exchange protein of wide distribution. Mediates at least a part of the Cl(-)/HCO3(-) exchange in cardiac myocytes. Both BAE3 and CAE3 forms transport Cl(-).
Endogenous Substrate(s) Anions
TCDB ID
2.A.31.1.3
Gene ID
6508
Reactome Pathway
Bicarbonate transporters (R-HSA-425381 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
BICARBONATE DMT5E36 Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.40E-01 -3.27E-02 -1.02E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.23E-01 3.66E-01 5.45E-01
Alopecia ED70 Skin from scalp 5.53E-06 -5.04E-01 -1.04E+00
Alzheimer's disease 8A20 Entorhinal cortex 1.27E-06 -3.47E-01 -8.12E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.54E-01 4.59E-02 3.12E-01
Aortic stenosis BB70 Calcified aortic valve 8.23E-01 -7.72E-02 -1.40E-01
Apnea 7A40 Hyperplastic tonsil 7.73E-01 7.60E-02 2.79E-01
Arthropathy FA00-FA5Z Peripheral blood 9.16E-01 0.00E+00 0.00E+00
Asthma CA23 Nasal and bronchial airway 4.20E-01 -2.25E-02 -5.02E-02
Atopic dermatitis EA80 Skin 4.12E-06 1.74E-01 1.60E+00
Autism 6A02 Whole blood 8.15E-01 7.10E-02 2.48E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.46E-01 -3.01E-01 -1.72E+00
Autosomal dominant monocytopenia 4B04 Whole blood 9.91E-01 -2.34E-02 -8.99E-02
Bacterial infection of gingival 1C1H Gingival tissue 9.46E-01 -8.92E-02 -2.45E-01
Batten disease 5C56.1 Whole blood 5.43E-01 4.04E-02 1.50E-01
Behcet's disease 4A62 Peripheral blood 3.15E-01 6.43E-02 3.06E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.11E-01 -4.17E-02 -1.13E-01
Bladder cancer 2C94 Bladder tissue 3.90E-04 4.74E-01 2.24E+00
Breast cancer 2C60-2C6Z Breast tissue 3.31E-12 1.84E-01 4.26E-01
Cardioembolic stroke 8B11.20 Whole blood 4.64E-02 0.00E+00 0.00E+00
Cervical cancer 2C77 Cervical tissue 6.06E-02 -1.60E-01 -5.31E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.16E-01 3.45E-02 1.05E-01
Chronic hepatitis C 1E51.1 Whole blood 3.91E-01 8.08E-02 3.92E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.32E-02 9.55E-02 4.31E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.39E-01 1.05E-01 4.00E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.97E-01 1.55E-01 7.56E-01
Colon cancer 2B90 Colon tissue 3.43E-03 6.53E-02 2.25E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.71E-03 -2.48E-01 -6.45E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.25E-01 -7.32E-02 -3.30E-01
Endometriosis GA10 Endometrium tissue 2.97E-02 8.95E-03 3.00E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.96E-01 -2.17E-01 -8.99E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.87E-03 -4.33E-01 -1.27E+00
Gastric cancer 2B72 Gastric tissue 7.67E-01 -1.18E-01 -2.18E-01
Glioblastopma 2A00.00 Nervous tissue 3.11E-88 -1.08E+00 -1.58E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.25E-01 2.12E-01 1.24E+00
Head and neck cancer 2D42 Head and neck tissue 5.11E-14 3.41E-01 1.25E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.87E-01 -3.52E-03 -4.62E-03
Huntington's disease 8A01.10 Whole blood 5.30E-01 -1.63E-02 -1.14E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.58E-01 2.80E-01 1.12E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.71E-01 8.04E-02 7.27E-01
Influenza 1.00E+30 Whole blood 7.80E-02 1.83E-01 9.62E-01
Interstitial cystitis GC00.3 Bladder tissue 7.79E-01 -5.10E-02 -1.41E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.33E-01 -6.50E-03 -1.81E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.20E-01 -3.29E-02 -1.32E-01
Ischemic stroke 8B11 Peripheral blood 9.78E-01 1.69E-03 6.83E-03
Juvenile idiopathic arthritis FA24 Peripheral blood 5.32E-03 -1.73E-01 -4.41E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.33E-01 8.91E-02 9.99E-02
Lateral sclerosis 8B60.4 Skin 9.83E-01 1.01E-01 4.73E-01
Liver cancer 2C12.0 Liver tissue 1.47E-01 -2.88E-01 -6.59E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.03E-02 3.50E-01 1.11E+00
Lung cancer 2C25 Lung tissue 8.22E-22 1.73E-01 7.05E-01
Lupus erythematosus 4A40 Whole blood 1.70E-01 -6.22E-02 -1.50E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.18E-01 -1.06E-02 -4.31E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.14E-01 1.18E-01 3.15E-01
Melanoma 2C30 Skin 1.13E-01 -1.52E-01 -2.54E-01
Multiple myeloma 2A83.1 Bone marrow 9.83E-03 -2.08E-01 -1.13E+00
Multiple myeloma 2A83.1 Peripheral blood 5.30E-01 -9.57E-02 -4.72E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.14E-02 -3.04E-01 -1.02E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.47E-01 2.48E-02 8.44E-02
Myelofibrosis 2A20.2 Whole blood 3.43E-01 -7.02E-02 -6.05E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.40E-03 2.42E-01 5.94E-01
Myopathy 8C70.6 Muscle tissue 1.75E-01 -1.60E-01 -8.34E-01
Neonatal sepsis KA60 Whole blood 7.33E-05 -2.07E-01 -6.87E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.92E-03 -4.69E-01 -1.20E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.64E-01 -4.15E-02 -3.03E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.90E-01 1.98E-01 7.95E-01
Olive pollen allergy CA08.00 Peripheral blood 3.00E-01 3.42E-01 8.48E-01
Oral cancer 2B6E Oral tissue 1.03E-01 -1.28E-01 -3.28E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.33E-01 6.47E-02 1.06E-01
Osteoporosis FB83.1 Bone marrow 1.98E-01 3.81E-01 1.43E+00
Ovarian cancer 2C73 Ovarian tissue 9.74E-05 -2.12E+00 -2.62E+00
Pancreatic cancer 2C10 Pancreas 3.68E-01 7.35E-02 1.63E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.29E-01 -1.13E-01 -1.98E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.76E-01 6.31E-02 2.77E-01
Pituitary cancer 2D12 Pituitary tissue 4.99E-01 3.46E-01 8.18E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.70E-04 8.71E-01 1.98E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.40E-01 6.66E-02 2.93E-01
Polycythemia vera 2A20.4 Whole blood 5.22E-01 -3.06E-02 -2.30E-01
Pompe disease 5C51.3 Biceps muscle 8.69E-03 5.00E-01 1.94E+00
Preterm birth KA21.4Z Myometrium 1.01E-01 6.63E-01 1.10E+00
Prostate cancer 2C82 Prostate 3.44E-02 2.28E-01 4.44E-01
Psoriasis EA90 Skin 7.62E-11 2.71E-01 8.02E-01
Rectal cancer 2B92 Rectal colon tissue 8.21E-01 -1.21E-01 -3.50E-01
Renal cancer 2C90-2C91 Kidney 1.59E-02 -1.03E-01 -2.64E-01
Retinoblastoma 2D02.2 Uvea 3.31E-07 -2.01E+00 -4.42E+00
Rheumatoid arthritis FA20 Synovial tissue 2.08E-01 1.31E-01 5.50E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.22E-01 -1.56E-02 -1.01E-01
Schizophrenia 6A20 Prefrontal cortex 1.45E-01 -4.86E-02 -4.74E-02
Schizophrenia 6A20 Superior temporal cortex 1.85E-01 3.43E-02 1.58E-01
Scleroderma 4A42.Z Whole blood 4.78E-02 2.82E-01 1.44E+00
Seizure 8A60-8A6Z Whole blood 2.74E-01 1.50E-01 9.77E-01
Sensitive skin EK0Z Skin 7.08E-01 2.64E-02 8.42E-02
Sepsis with septic shock 1G41 Whole blood 3.65E-02 -8.15E-03 -2.64E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.73E-02 5.62E-01 1.48E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.20E-03 8.88E-02 6.08E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.38E-01 8.34E-02 1.94E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.49E-01 -2.20E-01 -1.09E+00
Skin cancer 2C30-2C3Z Skin 1.48E-32 6.20E-01 1.30E+00
Thrombocythemia 3B63 Whole blood 9.91E-01 1.03E-02 8.90E-02
Thrombocytopenia 3B64 Whole blood 3.87E-01 -4.30E-02 -1.08E-01
Thyroid cancer 2D10 Thyroid 6.04E-02 2.05E-02 7.46E-02
Tibial muscular dystrophy 8C75 Muscle tissue 6.65E-01 -1.29E-01 -4.83E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.88E-01 -1.20E-01 -4.30E-01
Type 2 diabetes 5A11 Liver tissue 2.22E-01 8.06E-02 5.70E-01
Ureter cancer 2C92 Urothelium 4.23E-01 3.43E-02 1.28E-01
Uterine cancer 2C78 Endometrium tissue 3.38E-06 -2.29E-01 -5.58E-01
Vitiligo ED63.0 Skin 1.33E-01 -1.29E-01 -6.84E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The SLC4 family of bicarbonate (HCO??) transporters. Mol Aspects Med. 2013 Apr-Jun;34(2-3):159-82.