Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT85HYR)

DTP Name Calcium-binding mitochondrial carrier protein Aralar1 (SLC25A12)
Gene Name SLC25A12
UniProt ID
O75746 (CMC1_HUMAN)
VARIDT ID
DTD0170
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms AGC1; ARALAR; ARALAR1; EIEE39; Mitochondrial aspartate glutamate carrier 1; SLC25A12; Solute carrier family 25 member 12
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity Expressed predominantly in the heart andskeletal muscle, weakly in brain and kidney.
Sequence
MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLL
AGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTII
HHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL
DFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLA
GTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGAL
PYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGS
GSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRR
DGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGL
YKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPAD
VIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYEL
LQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF
KSPSVAVVQPKAAVAATQ
Function This transporter catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle.
Endogenous Substrate(s) Aspartate
TCDB ID
2.A.29.14.1
Gene ID
8604
Reactome Pathway
Gluconeogenesis (R-HSA-70263 )
Aspartate and asparagine metabolism (R-HSA-8963693 )
Mitochondrial protein import (R-HSA-1268020 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-glutamic acid DM4PUDW Schizophrenia 6A20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.03E-10 1.97E-01 5.69E-01
Adrenocortical carcinoma 2D11.Z Kidney 5.83E-01 3.84E-02 8.08E-02
Alopecia ED70 Skin from scalp 8.99E-04 1.50E-01 8.43E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.89E-03 -3.29E-01 -5.20E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.91E-01 8.72E-02 2.61E-01
Aortic stenosis BB70 Calcified aortic valve 7.48E-01 -2.28E-01 -1.88E-01
Apnea 7A40 Hyperplastic tonsil 4.62E-01 5.37E-02 1.19E-01
Arthropathy FA00-FA5Z Peripheral blood 9.31E-02 -2.69E-01 -1.15E+00
Asthma CA23 Nasal and bronchial airway 3.40E-03 2.69E-01 5.99E-01
Atopic dermatitis EA80 Skin 4.55E-02 7.68E-02 4.42E-01
Autism 6A02 Whole blood 5.01E-01 -7.08E-02 -2.60E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.87E-01 2.07E-01 1.05E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.33E-03 8.66E-01 4.01E+00
Bacterial infection of gingival 1C1H Gingival tissue 9.24E-04 -1.06E-01 -3.22E-01
Batten disease 5C56.1 Whole blood 6.43E-01 -1.73E-01 -6.81E-01
Behcet's disease 4A62 Peripheral blood 9.18E-01 1.16E-01 3.50E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.66E-01 -6.47E-02 -1.38E-01
Bladder cancer 2C94 Bladder tissue 6.87E-04 -5.60E-01 -2.16E+00
Breast cancer 2C60-2C6Z Breast tissue 1.15E-05 -1.96E-01 -3.29E-01
Cardioembolic stroke 8B11.20 Whole blood 8.01E-01 8.91E-02 4.34E-01
Cervical cancer 2C77 Cervical tissue 4.75E-02 -1.13E-01 -3.50E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.35E-01 1.40E-02 1.90E-02
Chronic hepatitis C 1E51.1 Whole blood 2.90E-01 -4.83E-03 -1.57E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 8.38E-01 7.82E-02 2.98E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.61E-06 -1.76E-01 -4.35E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.02E-02 -3.26E-01 -1.17E+00
Colon cancer 2B90 Colon tissue 2.19E-03 1.03E-01 3.17E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.12E-01 4.47E-01 1.25E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.11E-01 1.01E-01 2.36E-01
Endometriosis GA10 Endometrium tissue 5.13E-01 2.25E-01 3.14E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.47E-01 1.81E-01 8.92E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.12E-02 1.09E-01 6.00E-01
Gastric cancer 2B72 Gastric tissue 3.53E-01 -4.71E-01 -7.06E-01
Glioblastopma 2A00.00 Nervous tissue 7.88E-75 -1.05E+00 -1.34E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.08E-01 4.75E-01 6.46E-01
Head and neck cancer 2D42 Head and neck tissue 5.63E-13 -3.51E-01 -9.95E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.42E-01 -3.98E-01 -4.42E-01
Huntington's disease 8A01.10 Whole blood 5.48E-01 -1.04E-01 -3.41E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.91E-01 6.78E-02 1.38E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.42E-03 2.06E-01 1.36E+00
Influenza 1.00E+30 Whole blood 7.50E-02 -8.69E-01 -2.05E+00
Interstitial cystitis GC00.3 Bladder tissue 7.20E-01 2.75E-02 1.53E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.65E-04 -6.37E-01 -1.56E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.07E-01 -2.24E-02 -1.10E-01
Ischemic stroke 8B11 Peripheral blood 3.22E-01 -1.26E-01 -4.47E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.05E-06 -1.35E-01 -4.77E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.10E-01 -5.58E-02 -4.37E-02
Lateral sclerosis 8B60.4 Skin 1.19E-01 6.71E-01 1.42E+00
Liver cancer 2C12.0 Liver tissue 5.46E-04 1.97E-01 5.33E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.50E-02 4.14E-01 1.19E+00
Lung cancer 2C25 Lung tissue 1.44E-04 3.34E-02 1.18E-01
Lupus erythematosus 4A40 Whole blood 3.96E-02 2.66E-01 3.88E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.55E-01 5.48E-02 1.38E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.78E-01 1.80E-01 4.05E-01
Melanoma 2C30 Skin 6.41E-04 -6.13E-01 -7.76E-01
Multiple myeloma 2A83.1 Bone marrow 8.83E-05 5.32E-01 2.74E+00
Multiple myeloma 2A83.1 Peripheral blood 3.85E-01 -3.24E-01 -6.75E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.38E-02 -2.39E-01 -9.49E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.86E-02 9.24E-03 1.95E-02
Myelofibrosis 2A20.2 Whole blood 2.93E-01 6.71E-02 5.27E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.87E-02 -3.06E-01 -4.80E-01
Myopathy 8C70.6 Muscle tissue 1.20E-05 -6.42E-01 -3.80E+00
Neonatal sepsis KA60 Whole blood 1.50E-04 -3.22E-01 -7.89E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.53E-01 3.43E-01 6.59E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.59E-01 -7.23E-02 -5.62E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.24E-01 -1.36E-01 -4.95E-01
Olive pollen allergy CA08.00 Peripheral blood 8.01E-01 -3.48E-02 -1.22E-01
Oral cancer 2B6E Oral tissue 1.53E-01 -3.30E-01 -4.94E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.59E-01 -1.44E-01 -9.16E-02
Osteoporosis FB83.1 Bone marrow 2.99E-03 -1.31E+00 -4.61E+00
Ovarian cancer 2C73 Ovarian tissue 2.36E-01 1.31E-01 3.37E-01
Pancreatic cancer 2C10 Pancreas 5.11E-03 5.76E-01 1.00E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.24E-01 -4.39E-01 -6.29E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.47E-01 8.14E-02 4.60E-01
Pituitary cancer 2D12 Pituitary tissue 3.36E-02 3.27E-01 1.03E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.05E-04 4.99E-01 1.64E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.16E-01 9.11E-02 4.34E-01
Polycythemia vera 2A20.4 Whole blood 6.79E-01 -5.08E-02 -3.72E-01
Pompe disease 5C51.3 Biceps muscle 1.95E-03 -6.67E-01 -2.04E+00
Preterm birth KA21.4Z Myometrium 2.89E-01 2.29E-01 6.03E-01
Prostate cancer 2C82 Prostate 1.18E-01 4.67E-01 6.34E-01
Psoriasis EA90 Skin 1.34E-16 3.21E-01 1.03E+00
Rectal cancer 2B92 Rectal colon tissue 2.04E-02 -5.15E-01 -1.68E+00
Renal cancer 2C90-2C91 Kidney 4.44E-01 -4.57E-02 -1.58E-01
Retinoblastoma 2D02.2 Uvea 1.98E-08 -1.62E+00 -5.70E+00
Rheumatoid arthritis FA20 Synovial tissue 2.28E-01 -4.16E-01 -2.93E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.71E-01 -3.72E-02 -2.09E-01
Schizophrenia 6A20 Prefrontal cortex 5.03E-03 -4.50E-01 -5.41E-01
Schizophrenia 6A20 Superior temporal cortex 9.50E-01 -9.58E-02 -1.68E-01
Scleroderma 4A42.Z Whole blood 3.01E-02 -7.80E-02 -4.55E-01
Seizure 8A60-8A6Z Whole blood 6.14E-01 -5.66E-02 -1.49E-01
Sensitive skin EK0Z Skin 6.61E-01 -5.13E-02 -6.82E-01
Sepsis with septic shock 1G41 Whole blood 1.58E-10 -2.86E-01 -8.40E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.98E-01 4.65E-02 1.26E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.86E-03 -2.95E-01 -8.24E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.38E-01 -8.20E-01 -1.41E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.55E-06 6.86E-01 6.82E+00
Skin cancer 2C30-2C3Z Skin 3.73E-12 -3.18E-01 -7.37E-01
Thrombocythemia 3B63 Whole blood 2.54E-01 4.87E-02 3.63E-01
Thrombocytopenia 3B64 Whole blood 5.59E-01 -4.46E-01 -6.68E-01
Thyroid cancer 2D10 Thyroid 5.66E-23 -4.51E-01 -1.74E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.74E-06 -9.66E-01 -2.10E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.76E-02 -8.92E-01 -7.86E+00
Type 2 diabetes 5A11 Liver tissue 4.31E-01 -8.50E-02 -2.32E-01
Ureter cancer 2C92 Urothelium 3.49E-01 -1.58E-03 -1.07E-02
Uterine cancer 2C78 Endometrium tissue 7.24E-16 7.54E-01 1.07E+00
Vitiligo ED63.0 Skin 2.22E-01 3.80E-03 1.73E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Mitochondrial Aspartate/Glutamate Carrier SLC25A12 and Autism Spectrum Disorder: a Meta-Analysis. Mol Neurobiol. 2016 Apr;53(3):1579-1588.