Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT8Q56F)

DTP Name Probable low affinity copper uptake protein 2 (SLC31A2)
Gene Name SLC31A2
UniProt ID
O15432 (COPT2_HUMAN)
VARIDT ID
DTD0280
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Copper transporter 2; hCTR2; COPT2; CTR2; SLC31A2; Solute carrier family 31 member 2
DTP Family Copper Transporter (CTR) Family ;
Tissue Specificity Ubiquitous.
Sequence
MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPT
SISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTW
IFLGVVLGSAVGYYLAYPLLSTA
Function This transporter involved in low-affinity copper uptake.
Endogenous Substrate(s) Cu+
TCDB ID
1.A.56.1.9
Gene ID
1318

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.28E-06 -2.82E-01 -4.68E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.98E-03 2.42E-01 7.35E-01
Alopecia ED70 Skin from scalp 7.87E-01 2.84E-02 1.23E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.10E-02 3.34E-01 3.72E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.00E-01 -1.01E-01 -3.62E-01
Aortic stenosis BB70 Calcified aortic valve 3.87E-01 6.77E-01 6.31E-01
Apnea 7A40 Hyperplastic tonsil 3.23E-01 -1.38E-01 -3.16E-01
Arthropathy FA00-FA5Z Peripheral blood 2.72E-02 2.57E-01 7.42E-01
Asthma CA23 Nasal and bronchial airway 3.48E-06 6.20E-01 6.58E-01
Atopic dermatitis EA80 Skin 5.25E-16 -8.99E-01 -3.89E+00
Autism 6A02 Whole blood 9.27E-01 2.35E-01 5.94E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.40E-01 3.97E-01 6.31E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.24E-02 -9.94E-01 -1.94E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.54E-11 -3.89E-01 -1.19E+00
Batten disease 5C56.1 Whole blood 5.44E-01 1.13E-01 2.11E-01
Behcet's disease 4A62 Peripheral blood 1.87E-01 2.54E-01 5.61E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.99E-01 5.15E-02 9.55E-02
Bladder cancer 2C94 Bladder tissue 4.76E-01 -6.84E-02 -2.39E-01
Breast cancer 2C60-2C6Z Breast tissue 1.21E-28 -4.70E-01 -8.50E-01
Cardioembolic stroke 8B11.20 Whole blood 5.23E-03 1.98E-01 8.59E-01
Cervical cancer 2C77 Cervical tissue 9.45E-01 1.19E-01 2.02E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.02E-01 -4.45E-02 -4.42E-02
Chronic hepatitis C 1E51.1 Whole blood 8.21E-01 -7.39E-01 -4.98E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.86E-01 6.83E-02 1.24E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.69E-02 3.12E-01 5.57E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.86E-03 6.45E-01 1.68E+00
Colon cancer 2B90 Colon tissue 4.30E-30 -5.71E-01 -1.27E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.11E-01 -3.41E-01 -3.57E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.86E-01 -2.80E-01 -8.55E-01
Endometriosis GA10 Endometrium tissue 3.63E-01 3.96E-01 4.68E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.15E-01 -5.21E-01 -9.58E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.66E-01 3.50E-02 1.10E-01
Gastric cancer 2B72 Gastric tissue 4.41E-01 3.98E-02 5.70E-02
Glioblastopma 2A00.00 Nervous tissue 1.94E-42 -1.05E+00 -8.97E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.21E-08 -1.05E+00 -2.75E+00
Head and neck cancer 2D42 Head and neck tissue 1.10E-16 9.76E-01 1.08E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.28E-01 4.51E-01 4.43E-01
Huntington's disease 8A01.10 Whole blood 7.17E-01 -1.67E-02 -1.92E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.35E-01 -2.93E-01 -7.56E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.46E-01 -3.63E-03 -3.34E-02
Influenza 1.00E+30 Whole blood 7.52E-01 1.92E-01 7.26E-01
Interstitial cystitis GC00.3 Bladder tissue 4.76E-01 4.63E-02 1.90E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.17E-05 1.73E+00 3.34E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.67E-01 -6.61E-02 -1.72E-01
Ischemic stroke 8B11 Peripheral blood 9.11E-01 8.10E-02 1.75E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.05E-01 9.31E-02 1.89E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.62E-01 1.32E-02 3.11E-02
Lateral sclerosis 8B60.4 Skin 8.51E-01 1.17E-01 4.60E-01
Liver cancer 2C12.0 Liver tissue 5.68E-14 -7.57E-01 -1.61E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.47E-02 6.87E-01 1.15E+00
Lung cancer 2C25 Lung tissue 6.22E-54 -9.11E-01 -1.56E+00
Lupus erythematosus 4A40 Whole blood 8.99E-04 3.65E-01 2.27E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.44E-01 3.26E-02 1.33E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.24E-01 2.85E-03 5.45E-03
Melanoma 2C30 Skin 2.21E-03 -1.01E+00 -1.11E+00
Multiple myeloma 2A83.1 Bone marrow 7.05E-04 7.87E-01 1.87E+00
Multiple myeloma 2A83.1 Peripheral blood 8.69E-02 1.43E-01 6.49E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.84E-02 5.33E-01 1.83E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.43E-01 -6.64E-02 -1.40E-01
Myelofibrosis 2A20.2 Whole blood 2.42E-01 -1.84E-01 -5.82E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.92E-04 1.23E+00 9.66E-01
Myopathy 8C70.6 Muscle tissue 1.91E-03 6.49E-01 1.80E+00
Neonatal sepsis KA60 Whole blood 6.55E-06 5.34E-01 5.88E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.83E-16 -3.57E+00 -1.15E+01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.27E-01 3.92E-01 6.72E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.15E-01 4.50E-01 1.17E+00
Olive pollen allergy CA08.00 Peripheral blood 5.08E-01 3.74E-01 4.34E-01
Oral cancer 2B6E Oral tissue 1.14E-01 5.01E-01 4.76E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.53E-01 3.31E-01 3.63E-01
Osteoporosis FB83.1 Bone marrow 1.55E-01 -5.27E-01 -1.59E+00
Ovarian cancer 2C73 Ovarian tissue 8.54E-03 4.72E-01 1.01E+00
Pancreatic cancer 2C10 Pancreas 5.10E-02 -3.11E-01 -6.70E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.25E-01 1.36E-01 2.41E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.64E-05 1.41E+00 1.65E+00
Pituitary cancer 2D12 Pituitary tissue 1.95E-04 9.84E-01 2.12E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.48E-02 8.25E-01 1.91E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.73E-02 2.36E-01 1.10E+00
Polycythemia vera 2A20.4 Whole blood 6.15E-02 -2.77E-02 -9.03E-02
Pompe disease 5C51.3 Biceps muscle 1.09E-01 6.08E-01 1.19E+00
Preterm birth KA21.4Z Myometrium 4.50E-01 -1.24E-01 -1.63E-01
Prostate cancer 2C82 Prostate 1.07E-01 1.07E+00 9.84E-01
Psoriasis EA90 Skin 2.82E-04 1.60E-01 4.60E-01
Rectal cancer 2B92 Rectal colon tissue 1.63E-03 -9.69E-01 -2.41E+00
Renal cancer 2C90-2C91 Kidney 2.07E-02 7.28E-01 1.04E+00
Retinoblastoma 2D02.2 Uvea 5.04E-05 1.45E+00 4.17E+00
Rheumatoid arthritis FA20 Synovial tissue 9.39E-03 1.09E+00 1.50E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.76E-02 2.55E-02 5.53E-02
Schizophrenia 6A20 Prefrontal cortex 1.69E-01 1.13E-01 1.23E-01
Schizophrenia 6A20 Superior temporal cortex 2.81E-02 -4.47E-01 -7.16E-01
Scleroderma 4A42.Z Whole blood 2.48E-01 3.86E-01 1.16E+00
Seizure 8A60-8A6Z Whole blood 7.71E-01 -1.57E-02 -1.59E-02
Sensitive skin EK0Z Skin 8.16E-02 -1.34E-01 -6.72E-01
Sepsis with septic shock 1G41 Whole blood 5.42E-33 7.12E-01 1.48E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.43E-01 1.74E-01 6.10E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.79E-02 -7.96E-01 -9.90E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.85E-01 -2.58E-01 -6.62E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.31E-04 -6.35E-01 -9.69E+00
Skin cancer 2C30-2C3Z Skin 1.38E-50 -1.03E+00 -2.16E+00
Thrombocythemia 3B63 Whole blood 6.07E-01 -5.64E-02 -1.81E-01
Thrombocytopenia 3B64 Whole blood 6.43E-01 1.67E-01 2.93E-01
Thyroid cancer 2D10 Thyroid 2.84E-06 5.39E-01 8.29E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.57E-03 3.36E-01 1.01E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.73E-01 -5.67E-01 -9.66E-01
Type 2 diabetes 5A11 Liver tissue 1.91E-01 2.40E-01 8.05E-01
Ureter cancer 2C92 Urothelium 8.48E-01 4.39E-02 1.15E-01
Uterine cancer 2C78 Endometrium tissue 9.37E-09 4.86E-01 5.48E-01
Vitiligo ED63.0 Skin 4.60E-01 -1.16E-02 -5.85E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Copper transporter 2 regulates endocytosis and controls tumor growth and sensitivity to cisplatin in vivo. Mol Pharmacol. 2011 Jan;79(1):157-66.