Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT97OMP)

DTP Name Sodium/imino-acid transporter 1 (SLC6A20)
Gene Name SLC6A20
UniProt ID
Q9NP91 (S6A20_HUMAN)
VARIDT ID
DTD0453
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SIT1; SLC6A20; Sodium- and chloride-dependent transporter XTRP3; Solute carrier family 6 member 20; Transporter rB21A homolog; XT3; XTRP3
DTP Family Neurotransmitter:Sodium Symporter (NSS) Family ;
Tissue Specificity Kidney and small intestine. Expressed in theS3 segment of the proximal tubule.
Sequence
MEKARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLY
LELAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDP
LPWSVCPLNGNHTGYDEECEKASSTQYFWYRKTLNISPSLQENGGVQWEPALCLLLAWLV
VYLCILRGTESTGKVVYFTASLPYCVLIIYLIRGLTLHGATNGLMYMFTPKIEQLANPKA
WINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVSLINSFTSIFASIVTFSIYGF
KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSL
ESELDTAVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD
SKIISSHLPKEAISGLVCLVNCAIGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAV
CYVYGLRRFESDLKAMTGRAVSWYWKVMWAGVSPLLIVSLFVFYLSDYILTGTLKYQAWD
ASQGQLVTKDYPAYALAVIGLLVASSTMCIPLAALGTFVQRRLKRGDADPVA
Function This transporter mediates the calcium-dependent uptake of imino acids such as L-proline, N-methyl-L-proline and pipecolate as well as N-methylated amino acids. Involved in the transport of glycine.
Endogenous Substrate(s) Cl-; Na+
TCDB ID
2.A.22.6.8
Gene ID
54716
Reactome Pathway
Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660 )
Variant SLC6A20 contributes towards hyperglycinuria (HG) and iminoglycinuria (IG) (R-HSA-5619101 )
Variant SLC6A20 contributes towards hyperglycinuria (HG) and iminoglycinuria (IG) (R-HSA-5660686 )
Amino acid transport across the plasma membrane (R-HSA-352230 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.34E-01 4.92E-02 3.70E-01
Adrenocortical carcinoma 2D11.Z Kidney 5.20E-01 -9.35E-02 -3.92E-01
Alopecia ED70 Skin from scalp 1.05E-01 -1.09E-01 -3.85E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.60E-01 -3.58E-02 -5.81E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 1.71E-01 7.25E-02 6.35E-01
Aortic stenosis BB70 Calcified aortic valve 4.30E-01 -3.41E-01 -6.89E-01
Apnea 7A40 Hyperplastic tonsil 7.94E-02 -1.43E-01 -1.59E+00
Arthropathy FA00-FA5Z Peripheral blood 3.57E-01 2.63E-02 2.10E-01
Asthma CA23 Nasal and bronchial airway 2.48E-04 3.84E-01 4.94E-01
Atopic dermatitis EA80 Skin 9.55E-02 1.92E-02 2.13E-01
Autism 6A02 Whole blood 5.11E-01 -3.59E-03 -2.19E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.07E-01 -1.10E-01 -1.64E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.98E-01 -7.88E-02 -7.25E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.13E-03 8.52E-02 4.67E-01
Batten disease 5C56.1 Whole blood 4.71E-01 8.58E-02 7.68E-01
Behcet's disease 4A62 Peripheral blood 3.48E-01 -2.04E-02 -7.76E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.58E-01 -6.28E-03 -3.60E-02
Bladder cancer 2C94 Bladder tissue 7.89E-04 3.95E-01 2.19E+00
Breast cancer 2C60-2C6Z Breast tissue 6.43E-02 7.86E-03 3.72E-02
Cardioembolic stroke 8B11.20 Whole blood 8.05E-01 5.30E-02 2.35E-01
Cervical cancer 2C77 Cervical tissue 1.18E-01 -1.50E-01 -4.31E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.21E-01 3.35E-02 1.85E-01
Chronic hepatitis C 1E51.1 Whole blood 6.89E-01 -1.94E-02 -1.59E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.79E-01 -1.52E-01 -3.50E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.09E-02 -6.82E-02 -1.50E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.30E-02 4.67E-01 2.23E+00
Colon cancer 2B90 Colon tissue 2.29E-45 8.37E-01 1.48E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.68E-01 -1.91E-01 -1.53E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.72E-01 -5.08E-02 -2.79E-01
Endometriosis GA10 Endometrium tissue 1.06E-01 4.65E-02 2.34E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.53E-01 -1.09E-02 -7.94E-02
Familial hypercholesterolemia 5C80.00 Whole blood 5.46E-03 -8.85E-02 -5.11E-01
Gastric cancer 2B72 Gastric tissue 7.57E-02 9.33E-01 1.95E+00
Glioblastopma 2A00.00 Nervous tissue 4.44E-36 -3.44E-01 -6.49E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.05E-03 -1.45E-01 -1.18E+00
Head and neck cancer 2D42 Head and neck tissue 1.33E-10 -1.85E-01 -3.05E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.20E-01 -1.40E-02 -4.76E-02
Huntington's disease 8A01.10 Whole blood 2.54E-01 -2.38E-03 -1.65E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.37E-01 -3.29E-02 -9.03E-02
Immunodeficiency 4A00-4A20 Peripheral blood 1.43E-02 9.78E-02 2.79E+00
Influenza 1.00E+30 Whole blood 5.29E-03 3.62E-01 3.18E+00
Interstitial cystitis GC00.3 Bladder tissue 7.78E-01 6.63E-02 1.08E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.98E-02 4.68E-01 1.24E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.31E-01 4.50E-02 9.22E-02
Ischemic stroke 8B11 Peripheral blood 6.91E-02 6.01E-02 5.45E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.75E-02 5.45E-02 3.47E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.77E-01 6.35E-03 1.76E-02
Lateral sclerosis 8B60.4 Skin 2.48E-01 7.83E-02 1.42E+00
Liver cancer 2C12.0 Liver tissue 5.38E-01 -9.23E-02 -5.69E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.40E-02 -9.12E-02 -1.39E+00
Lung cancer 2C25 Lung tissue 5.57E-08 -5.38E-01 -1.07E+00
Lupus erythematosus 4A40 Whole blood 3.16E-01 -1.83E-02 -5.88E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.31E-01 2.09E-03 1.12E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.25E-01 -2.72E-03 -1.74E-02
Melanoma 2C30 Skin 9.03E-01 5.18E-02 1.58E-01
Multiple myeloma 2A83.1 Bone marrow 2.02E-01 1.04E-01 7.01E-01
Multiple myeloma 2A83.1 Peripheral blood 6.61E-01 8.03E-02 6.32E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.85E-01 -7.99E-02 -3.88E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.42E-02 -4.57E-02 -3.92E-01
Myelofibrosis 2A20.2 Whole blood 6.57E-02 9.49E-02 6.21E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.32E-02 1.38E-01 3.67E-01
Myopathy 8C70.6 Muscle tissue 9.80E-02 -1.10E-01 -9.08E-01
Neonatal sepsis KA60 Whole blood 2.28E-01 9.73E-03 4.40E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.55E-04 -9.43E-01 -2.02E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.66E-01 3.69E-03 2.45E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.33E-01 -2.64E-02 -5.32E-01
Olive pollen allergy CA08.00 Peripheral blood 1.83E-01 1.46E-01 1.02E+00
Oral cancer 2B6E Oral tissue 9.23E-07 -2.72E-01 -1.16E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.19E-02 -2.35E-01 -1.08E+00
Osteoporosis FB83.1 Bone marrow 1.13E-02 1.61E-01 2.51E+00
Ovarian cancer 2C73 Ovarian tissue 9.70E-02 1.14E-01 2.66E-01
Pancreatic cancer 2C10 Pancreas 3.19E-01 1.00E-02 1.25E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 1.77E-01 2.14E-02 1.74E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.47E-01 8.05E-03 8.43E-02
Pituitary cancer 2D12 Pituitary tissue 1.98E-03 -4.70E-01 -1.13E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.86E-03 -3.57E-01 -7.53E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.20E-01 -2.96E-02 -2.37E-01
Polycythemia vera 2A20.4 Whole blood 7.05E-07 1.34E-01 9.44E-01
Pompe disease 5C51.3 Biceps muscle 5.05E-01 -8.14E-03 -9.20E-02
Preterm birth KA21.4Z Myometrium 3.27E-01 2.44E-02 3.21E-01
Prostate cancer 2C82 Prostate 4.44E-03 -4.36E-01 -1.12E+00
Psoriasis EA90 Skin 3.61E-08 -8.39E-02 -3.68E-01
Rectal cancer 2B92 Rectal colon tissue 6.02E-06 1.08E+00 3.39E+00
Renal cancer 2C90-2C91 Kidney 4.57E-02 -5.97E-01 -1.04E+00
Retinoblastoma 2D02.2 Uvea 5.55E-01 -7.18E-02 -6.75E-01
Rheumatoid arthritis FA20 Synovial tissue 4.35E-03 -4.90E-01 -1.94E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.68E-01 -1.42E-01 -2.74E-01
Schizophrenia 6A20 Prefrontal cortex 2.56E-01 -9.95E-02 -3.40E-01
Schizophrenia 6A20 Superior temporal cortex 4.12E-02 -7.70E-02 -6.93E-01
Scleroderma 4A42.Z Whole blood 9.07E-02 8.64E-02 8.11E-01
Seizure 8A60-8A6Z Whole blood 3.04E-02 -1.32E-01 -8.28E-01
Sensitive skin EK0Z Skin 7.27E-01 3.72E-03 4.56E-02
Sepsis with septic shock 1G41 Whole blood 2.33E-04 2.35E-02 1.21E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.34E-01 -8.78E-02 -3.67E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.41E-01 3.40E-02 1.79E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.57E-02 1.76E-01 2.20E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.54E-01 -9.95E-03 -5.62E-01
Skin cancer 2C30-2C3Z Skin 2.71E-11 -1.83E-01 -5.61E-01
Thrombocythemia 3B63 Whole blood 2.99E-03 1.19E-01 7.33E-01
Thrombocytopenia 3B64 Whole blood 3.45E-01 -1.17E-01 -6.54E-01
Thyroid cancer 2D10 Thyroid 4.64E-19 2.84E-01 1.47E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.22E-03 -1.72E-01 -1.18E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.01E-02 -4.33E-01 -1.48E+00
Type 2 diabetes 5A11 Liver tissue 7.44E-01 -1.20E-02 -1.17E-01
Ureter cancer 2C92 Urothelium 5.26E-01 -1.61E-03 -1.14E-02
Uterine cancer 2C78 Endometrium tissue 9.38E-11 1.39E-01 3.70E-01
Vitiligo ED63.0 Skin 9.52E-01 7.43E-03 3.92E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases