Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT9U216)

DTP Name Excitatory amino acid transporter 1 (SLC1A3)
Gene Name SLC1A3
UniProt ID
P43003 (EAA1_HUMAN)
VARIDT ID
DTD0131
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms EA6; EAAT1; GLAST; GLAST-1; GLAST1; SLC1A3; Sodium-dependent glutamate/aspartate transporter 1; Solute carrier family 1 member 3
DTP Family Dicarboxylate/Amino Acid:Cation (Na(+) Or H(+)) Symporter (DAACS) Family ;
Tissue Specificity Detected in brain (PubMed:8218410,PubMed:7521911, PubMed:8123008). Detected at very much lowerlevels in heart, lung, placenta and skeletal muscle(PubMed:7521911, PubMed:8123008). Highly expressed in cerebellum,but also found in frontal cortex, hippocampus and basal ganglia(PubMed:7521911).
Sequence
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIV
GTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPP
NLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSET
KM
Function
This sodium-dependent, high-affinity amino acid transporter functions as a symporter and mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport. Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate.
Endogenous Substrate(s) Na+; Aspartate
TCDB ID
2.A.23.2.6
Gene ID
6507
KEGG Pathway
Synaptic vesicle cycle (hsa04721 )
Glutamatergic synapse (hsa04724 )
Huntington disease (hsa05016 )
Reactome Pathway
Glutamate Neurotransmitter Release Cycle (R-HSA-210500 )
Transport of inorganic cations/anions and amino acids/oligopeptides (R-HSA-425393 )
Defective SLC1A3 causes episodic ataxia 6 (EA6) (R-HSA-5619062 )
Astrocytic Glutamate-Glutamine Uptake And Metabolism (R-HSA-210455 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-glutamic acid DM4PUDW Schizophrenia 6A20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.02E-01 2.02E-02 7.90E-02
Adrenocortical carcinoma 2D11.Z Kidney 1.29E-01 5.92E-02 1.63E-01
Alopecia ED70 Skin from scalp 1.57E-05 2.07E-01 9.37E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.99E-09 3.33E-01 5.00E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.98E-01 -3.18E-02 -8.12E-02
Aortic stenosis BB70 Calcified aortic valve 3.39E-01 -1.58E-01 -3.73E-01
Apnea 7A40 Hyperplastic tonsil 2.90E-02 -6.86E-01 -2.91E+00
Arthropathy FA00-FA5Z Peripheral blood 9.02E-02 6.72E-02 5.00E-01
Asthma CA23 Nasal and bronchial airway 3.52E-04 3.79E-01 8.00E-01
Atopic dermatitis EA80 Skin 2.14E-01 -1.34E-01 -6.67E-01
Autism 6A02 Whole blood 4.16E-01 -3.68E-02 -2.91E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.95E-01 -7.08E-02 -6.30E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.30E-01 3.09E-02 3.06E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.06E-11 3.25E-01 1.06E+00
Batten disease 5C56.1 Whole blood 3.47E-02 1.79E-01 1.62E+00
Behcet's disease 4A62 Peripheral blood 6.35E-02 1.14E-01 9.83E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.13E-02 1.57E-01 4.87E-01
Bladder cancer 2C94 Bladder tissue 4.51E-02 -3.06E-01 -1.07E+00
Breast cancer 2C60-2C6Z Breast tissue 5.06E-07 -1.39E-01 -2.23E-01
Cardioembolic stroke 8B11.20 Whole blood 7.84E-11 4.57E-01 2.34E+00
Cervical cancer 2C77 Cervical tissue 5.01E-01 -2.14E-01 -5.61E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.83E-01 3.04E-02 1.83E-01
Chronic hepatitis C 1E51.1 Whole blood 1.03E-01 1.04E-01 7.35E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.19E-03 1.70E-01 4.92E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.08E-01 1.85E-03 7.86E-03
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.19E-01 -1.91E-01 -4.77E-01
Colon cancer 2B90 Colon tissue 2.07E-19 1.50E-01 6.63E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.29E-01 -1.45E-01 -6.43E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.11E-01 -6.61E-02 -4.70E-01
Endometriosis GA10 Endometrium tissue 4.10E-02 9.63E-02 3.98E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.47E-01 1.02E-02 8.78E-02
Familial hypercholesterolemia 5C80.00 Whole blood 2.65E-01 6.71E-02 5.17E-01
Gastric cancer 2B72 Gastric tissue 1.05E-01 1.55E-01 6.01E-01
Glioblastopma 2A00.00 Nervous tissue 4.91E-06 3.70E-01 4.96E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.89E-01 -1.63E-01 -2.98E-01
Head and neck cancer 2D42 Head and neck tissue 3.88E-29 8.44E-01 1.87E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.63E-01 5.69E-02 1.74E-01
Huntington's disease 8A01.10 Whole blood 1.08E-01 1.10E-01 1.55E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.04E-01 -6.92E-01 -1.29E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.15E-01 6.06E-02 1.06E+00
Influenza 1.00E+30 Whole blood 1.52E-03 -9.32E-01 -8.75E+00
Interstitial cystitis GC00.3 Bladder tissue 9.61E-01 -2.72E-02 -1.37E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.15E-05 1.47E+00 5.14E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.89E-01 4.36E-02 9.20E-02
Ischemic stroke 8B11 Peripheral blood 6.20E-01 2.01E-02 7.57E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 5.34E-12 3.48E-01 9.73E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.06E-01 5.34E-01 4.81E-01
Lateral sclerosis 8B60.4 Skin 5.02E-01 -1.39E-01 -5.86E-01
Liver cancer 2C12.0 Liver tissue 1.23E-15 4.37E-01 1.63E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.56E-04 7.61E-01 2.19E+00
Lung cancer 2C25 Lung tissue 5.16E-01 8.96E-02 1.79E-01
Lupus erythematosus 4A40 Whole blood 6.79E-06 8.36E-02 3.70E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.53E-02 8.17E-02 4.49E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.14E-01 -1.44E-01 -4.51E-01
Melanoma 2C30 Skin 1.61E-01 -2.80E-01 -5.01E-01
Multiple myeloma 2A83.1 Bone marrow 3.08E-02 -4.06E-01 -6.99E-01
Multiple myeloma 2A83.1 Peripheral blood 5.02E-01 -2.50E-02 -2.48E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.99E-01 7.13E-02 2.81E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.86E-01 1.49E-01 3.81E-01
Myelofibrosis 2A20.2 Whole blood 4.02E-05 1.13E-01 1.20E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.00E-02 6.10E-02 1.43E-01
Myopathy 8C70.6 Muscle tissue 2.99E-01 -2.48E-01 -9.77E-01
Neonatal sepsis KA60 Whole blood 4.67E-30 6.22E-01 2.67E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.56E-06 -1.24E+00 -2.89E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.90E-01 9.45E-02 4.73E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.81E-02 4.17E-01 1.68E+00
Olive pollen allergy CA08.00 Peripheral blood 6.21E-01 1.72E-01 2.78E-01
Oral cancer 2B6E Oral tissue 4.21E-01 -1.56E-01 -2.36E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.77E-01 -5.72E-01 -8.53E-01
Osteoporosis FB83.1 Bone marrow 1.89E-01 4.72E-01 9.85E-01
Ovarian cancer 2C73 Ovarian tissue 2.36E-02 5.92E-01 8.51E-01
Pancreatic cancer 2C10 Pancreas 3.99E-01 1.24E-01 2.45E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.06E-01 -4.40E-01 -1.15E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.11E-03 2.06E-01 1.73E+00
Pituitary cancer 2D12 Pituitary tissue 9.07E-03 -5.36E-01 -8.08E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.55E-02 -6.17E-01 -9.08E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.51E-02 -5.41E-02 -5.94E-01
Polycythemia vera 2A20.4 Whole blood 1.66E-03 5.41E-02 5.87E-01
Pompe disease 5C51.3 Biceps muscle 4.40E-03 -5.38E-01 -2.46E+00
Preterm birth KA21.4Z Myometrium 1.32E-01 6.47E-01 2.54E+00
Prostate cancer 2C82 Prostate 8.64E-01 5.05E-01 6.64E-01
Psoriasis EA90 Skin 3.47E-13 3.77E-01 1.08E+00
Rectal cancer 2B92 Rectal colon tissue 9.72E-01 2.17E-02 1.04E-01
Renal cancer 2C90-2C91 Kidney 1.71E-06 7.68E-01 2.48E+00
Retinoblastoma 2D02.2 Uvea 1.20E-08 -2.93E+00 -5.76E+00
Rheumatoid arthritis FA20 Synovial tissue 2.61E-01 -3.43E-01 -1.30E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.58E-01 1.45E-02 1.56E-01
Schizophrenia 6A20 Prefrontal cortex 4.94E-01 2.87E-02 2.07E-02
Schizophrenia 6A20 Superior temporal cortex 5.72E-01 2.40E-01 6.68E-01
Scleroderma 4A42.Z Whole blood 1.73E-01 6.75E-02 4.76E-01
Seizure 8A60-8A6Z Whole blood 3.88E-01 -3.46E-02 -1.57E-01
Sensitive skin EK0Z Skin 6.45E-01 -7.92E-02 -4.67E-01
Sepsis with septic shock 1G41 Whole blood 1.14E-68 5.77E-01 2.10E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.26E-01 -1.01E-01 -7.52E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.07E-02 1.27E-01 8.77E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.02E-01 -1.49E-01 -3.30E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.88E-02 5.10E-01 1.40E+00
Skin cancer 2C30-2C3Z Skin 4.34E-08 2.07E-01 5.44E-01
Thrombocythemia 3B63 Whole blood 5.25E-01 1.65E-02 1.81E-01
Thrombocytopenia 3B64 Whole blood 3.46E-01 1.50E+00 1.87E+00
Thyroid cancer 2D10 Thyroid 1.44E-15 5.89E-01 1.11E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.81E-01 -3.10E-01 -1.02E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.47E-01 5.50E-02 3.11E-01
Type 2 diabetes 5A11 Liver tissue 9.26E-02 9.32E-02 3.29E+00
Ureter cancer 2C92 Urothelium 5.32E-01 8.83E-03 4.29E-02
Uterine cancer 2C78 Endometrium tissue 3.02E-36 8.75E-01 1.86E+00
Vitiligo ED63.0 Skin 4.80E-01 -2.96E-02 -1.36E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name HUMAN excitatory amino acid transporter 1 (EAAT1) DTT Info

References

1 The SLC1 high-affinity glutamate and neutral amino acid transporter family. Mol Aspects Med. 2013 Apr-Jun;34(2-3):108-20.