Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTAOPTV)

• DTP Name: Proton-coupled amino acid transporter 2 (SLC36A2)
• Gene Name: SLC36A2
• UniProt ID: Q495M3 (S36A2_HUMAN)
• VARIDT ID: DTD0319
• Synonyms: PAT2; Proton/amino acid transporter 2; SLC36A2; Solute carrier family 36 member 2; TRAMD1; Tramdorin-1
• DTP Family: Amino Acid/Auxin Permease (AAAP) Family
• Tissue Specificity: Abundantly expressed in kidney and muscle.Expressed in the S1 segment of the proximal tubule close to theglomerulus.
• Sequence:
  MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQAL
  IHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPF
  MDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAV
  NSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLV
  IIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILS
  LGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYV
  PAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALAL
  IIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTT
  FVR
• Function: This transporter involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids. Transports glycine and proline. Inhibited by sarcosine.
• Endogenous Substrate(s): H+
• TCDB ID: 2.A.18.8.6
• Gene ID: 153201
• KEGG Pathway: Protein digestion and absorption (hsa04974)
• Reactome Pathway:
  Proton-coupled neutral amino acid transporters (R-HSA-428559)
  Defective SLC36A2 causes iminoglycinuria (IG) and hyperglycinuria (HG) (R-HSA-5619041)
  Amino acid transport across the plasma membrane (R-HSA-352230)

Molecular Interaction Atlas (MIA) of This DTP

1 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Cycloserine	DMT1I52	Bacterial infection	1A00-1C4Z	Approved	[2]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Solute carrier family 36 member 2 (SLC36A2) DTT Info
• DTP DTT Type: Literature-reported

1 Discontinued Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NOX-200	DM78P4X	Rheumatoid arthritis	FA20	Terminated	[1]

1 Investigative Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
5-hydroxy-L-tryptophan	DMDWZGJ	Discovery agent	N.A.	Investigative	[1]

References

• [1] Amino acid derivatives are substrates or non-transported inhibitors of the amino acid transporter PAT2 (slc36a2). Biochim Biophys Acta. 2011 Jan;1808(1):260-70.
• [2] Substrate specificity and functional characterisation of the H+/amino acid transporter rat PAT2 (Slc36a2). Br J Pharmacol. 2005 Jan;144(1):28-41.