Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTB0Q3P)

DTP Name Anion exchange protein 1 (SLC4A1)
Gene Name SLC4A1
UniProt ID
P02730 (B3AT_HUMAN)
VARIDT ID
DTD0380
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms AE 1; AE1; Band 3 anion transport protein; Anion exchanger 1; BND3; CD233; CHC; DI; EMPB3; EPB3; FR; RTA1A; SAO; SLC4A1; SPH4; SW; Solute carrier family 4 member 1; WD; WD1; WR
DTP Family Anion Exchanger (AE) Family ;
Tissue Specificity Detected in erythrocytes (at protein level)(PubMed:7506871, PubMed:26542571). Isoform 2 is expressed inkidney (at protein level) (PubMed:7506871).
Sequence
MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVE
LQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVL
LDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTR
SGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQP
VLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYM
AQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK
GLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSPQVLAAVIFIYFAALSPA
ITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCE
TNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKL
IKIFQDHPLQKTYNYNVLMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGK
LRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKVSNSSARGWVIHPLGLRSEFP
IWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFG
MPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPIL
SRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQ
IICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDEEEG
RDEYDEVAMPV
Function
This transporter functions both as a transporter that mediates electroneutral anion exchange across the cell membrane and as a structural protein. Functions as a transporter that mediates the 1:1 exchange of inorganic anions across the erythrocyte membrane. Mediates chloride-bicarbonate exchange in the kidney, and is required for normal acidification of the urine.
Endogenous Substrate(s) Anions; Phospholipids
TCDB ID
2.A.31.1.1
Gene ID
6521
KEGG Pathway
Collecting duct acid secretion (hsa04966 )
Reactome Pathway
Erythrocytes take up oxygen and release carbon dioxide (R-HSA-1247673 )
Bicarbonate transporters (R-HSA-425381 )
Defective SLC4A1 causes hereditary spherocytosis type 4 (HSP4), distal renal tubular acidosis (dRTA) and dRTA with hemolytic anemia (dRTA-HA) (R-HSA-5619050 )
Erythrocytes take up carbon dioxide and release oxygen (R-HSA-1237044 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.67E-33 -2.43E+00 -1.99E+00
Adrenocortical carcinoma 2D11.Z Kidney 2.79E-01 -6.94E-02 -2.39E-01
Alopecia ED70 Skin from scalp 1.03E-05 -3.84E-01 -1.08E+00
Alzheimer's disease 8A20 Entorhinal cortex 9.44E-01 1.50E-02 1.04E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.53E-01 -7.18E-02 -5.40E-01
Aortic stenosis BB70 Calcified aortic valve 9.48E-01 1.20E-01 1.71E-01
Apnea 7A40 Hyperplastic tonsil 3.77E-01 -2.10E-01 -1.14E+00
Arthropathy FA00-FA5Z Peripheral blood 4.81E-01 3.92E-01 5.49E-01
Asthma CA23 Nasal and bronchial airway 3.84E-01 -2.20E-02 -6.36E-02
Atopic dermatitis EA80 Skin 2.29E-02 -6.78E-02 -4.70E-01
Autism 6A02 Whole blood 6.24E-02 -4.36E-01 -5.98E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.98E-01 -2.44E-01 -1.63E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.10E-01 2.58E-01 4.89E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.44E-03 9.15E-02 3.86E-01
Batten disease 5C56.1 Whole blood 1.23E-01 -6.49E-02 -3.55E-01
Behcet's disease 4A62 Peripheral blood 4.27E-01 3.71E-01 4.74E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.21E-02 -5.03E-02 -3.63E-01
Bladder cancer 2C94 Bladder tissue 6.19E-04 4.83E-01 1.98E+00
Breast cancer 2C60-2C6Z Breast tissue 7.71E-17 -1.55E-01 -4.77E-01
Cardioembolic stroke 8B11.20 Whole blood 9.05E-02 -1.52E-01 -1.82E-01
Cervical cancer 2C77 Cervical tissue 6.93E-01 -3.88E-02 -1.80E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.05E-04 3.37E-01 1.47E+00
Chronic hepatitis C 1E51.1 Whole blood 6.57E-01 2.58E-02 3.21E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.81E-04 1.80E-01 7.20E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.08E-01 8.12E-02 2.16E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.16E-02 4.23E-02 5.27E-01
Colon cancer 2B90 Colon tissue 9.37E-02 -2.58E-02 -1.29E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.51E-01 9.74E-03 3.35E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.58E-01 -4.42E-02 -2.14E-01
Endometriosis GA10 Endometrium tissue 3.91E-01 3.35E-02 1.38E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.48E-01 -4.40E-02 -1.48E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.09E-10 -2.17E+00 -1.68E+00
Gastric cancer 2B72 Gastric tissue 1.42E-01 -2.81E-01 -1.07E+00
Glioblastopma 2A00.00 Nervous tissue 6.37E-39 -2.06E-01 -8.81E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.36E-04 -2.07E-01 -1.94E+00
Head and neck cancer 2D42 Head and neck tissue 3.44E-05 -7.82E-02 -4.58E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.41E-02 -1.01E-01 -4.46E-01
Huntington's disease 8A01.10 Whole blood 4.13E-01 1.97E-01 3.02E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.86E-01 -5.79E-02 -3.66E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.63E-01 3.05E-02 4.78E-01
Influenza 1.00E+30 Whole blood 2.53E-03 5.96E-01 5.71E+00
Interstitial cystitis GC00.3 Bladder tissue 8.69E-01 5.28E-02 6.21E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.96E-02 -9.70E-02 -3.35E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.00E-01 1.03E-01 3.65E-01
Ischemic stroke 8B11 Peripheral blood 1.31E-01 2.03E-01 3.30E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.12E-01 -1.28E-01 -7.71E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 9.04E-01 -6.41E-02 -4.08E-01
Lateral sclerosis 8B60.4 Skin 4.58E-01 7.86E-02 3.97E-01
Liver cancer 2C12.0 Liver tissue 2.34E-10 -2.16E-01 -1.22E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.03E-02 -2.01E-01 -1.35E+00
Lung cancer 2C25 Lung tissue 2.47E-11 -1.12E-01 -5.16E-01
Lupus erythematosus 4A40 Whole blood 1.27E-09 -1.02E+00 -5.89E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.75E-01 2.82E-02 3.12E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.62E-01 1.03E-02 8.00E-02
Melanoma 2C30 Skin 2.61E-01 -5.76E-02 -1.36E-01
Multiple myeloma 2A83.1 Bone marrow 3.91E-01 -5.30E-02 -2.83E-01
Multiple myeloma 2A83.1 Peripheral blood 2.64E-01 6.49E-02 3.42E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.87E-01 -2.28E-02 -2.08E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.68E-01 2.27E-01 3.26E-01
Myelofibrosis 2A20.2 Whole blood 4.15E-02 9.36E-01 1.04E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.90E-01 3.05E-01 1.07E-01
Myopathy 8C70.6 Muscle tissue 9.54E-03 -7.09E-02 -7.87E-01
Neonatal sepsis KA60 Whole blood 2.36E-01 -2.53E-01 -2.50E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.52E-06 -1.01E+00 -3.09E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.32E-02 -1.23E-01 -1.79E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.13E-01 1.34E-01 1.36E+00
Olive pollen allergy CA08.00 Peripheral blood 6.98E-02 2.02E-01 1.29E+00
Oral cancer 2B6E Oral tissue 1.88E-05 -3.21E-01 -1.42E+00
Osteoarthritis FA00-FA0Z Synovial tissue 9.21E-01 -6.46E-02 -2.40E-01
Osteoporosis FB83.1 Bone marrow 6.51E-02 2.26E-01 4.05E+00
Ovarian cancer 2C73 Ovarian tissue 1.16E-01 -1.74E-01 -7.37E-01
Pancreatic cancer 2C10 Pancreas 2.32E-02 -3.35E-01 -1.01E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.44E-01 5.41E-02 3.10E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.75E-04 7.50E-01 1.29E+00
Pituitary cancer 2D12 Pituitary tissue 9.73E-01 1.35E-02 5.21E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.93E-01 -5.57E-02 -2.48E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.59E-01 -2.15E-02 -2.25E-01
Polycythemia vera 2A20.4 Whole blood 5.82E-02 3.90E-01 4.28E-01
Pompe disease 5C51.3 Biceps muscle 3.08E-02 -1.39E-01 -1.54E+00
Preterm birth KA21.4Z Myometrium 2.17E-01 1.61E-01 7.16E-01
Prostate cancer 2C82 Prostate 1.17E-04 -8.66E-01 -1.51E+00
Psoriasis EA90 Skin 1.48E-11 -1.87E-01 -5.47E-01
Rectal cancer 2B92 Rectal colon tissue 3.96E-01 -7.93E-02 -4.57E-01
Renal cancer 2C90-2C91 Kidney 1.68E-05 -2.17E+00 -2.98E+00
Retinoblastoma 2D02.2 Uvea 1.91E-06 -3.25E-01 -3.76E+00
Rheumatoid arthritis FA20 Synovial tissue 5.37E-02 -1.17E-01 -3.65E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.19E-01 1.75E-02 1.56E-01
Schizophrenia 6A20 Prefrontal cortex 1.89E-02 3.61E-02 1.85E-01
Schizophrenia 6A20 Superior temporal cortex 9.20E-01 2.27E-02 2.71E-01
Scleroderma 4A42.Z Whole blood 4.60E-07 -1.05E+00 -2.58E+00
Seizure 8A60-8A6Z Whole blood 7.71E-02 -6.53E-01 -5.00E-01
Sensitive skin EK0Z Skin 6.47E-01 -1.38E-01 -7.49E-01
Sepsis with septic shock 1G41 Whole blood 1.88E-10 -6.31E-01 -8.44E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.86E-03 1.63E+00 2.33E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.16E-05 7.16E-01 3.32E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.34E-01 -2.73E-02 -2.96E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.83E-01 1.38E-01 7.84E-01
Skin cancer 2C30-2C3Z Skin 2.45E-20 -3.48E-01 -7.76E-01
Thrombocythemia 3B63 Whole blood 8.91E-01 2.68E-01 3.02E-01
Thrombocytopenia 3B64 Whole blood 3.10E-01 1.24E-01 6.31E-01
Thyroid cancer 2D10 Thyroid 2.27E-01 2.45E-02 1.30E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.65E-03 -1.65E-01 -1.08E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.22E-01 1.58E-01 1.60E+00
Type 2 diabetes 5A11 Liver tissue 6.77E-01 -2.97E-02 -2.80E-01
Ureter cancer 2C92 Urothelium 7.16E-01 2.61E-02 1.04E-01
Uterine cancer 2C78 Endometrium tissue 2.73E-03 -8.86E-02 -3.77E-01
Vitiligo ED63.0 Skin 8.76E-01 1.12E-02 1.34E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases