Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTB930Q)

DTP Name UDP-N-acetylglucosamine transporter (SLC35A3)
Gene Name SLC35A3
UniProt ID
Q9Y2D2 (S35A3_HUMAN)
VARIDT ID
DTD0289
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms AMRS; Golgi UDP-GlcNAc transporter; SLC35A3; Solute carrier family 35 member A3
DTP Family Drug/Metabolite Transporter (DMT) Superfamily
CMP-Sialate:CMP Antiporter (CSA) Family
Sequence
MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYK
DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLK
ILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVL
TACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGY
NRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFL
GAILVITATFLYGYDPKPAGNPTKA
Function
This transporter is uridine diphosphate-N-acetylglucosamine (UDP-GlcNAc) transporter in the Golgi apparatus. It may supply UDP-GlcNAc as substrate for Golgi-resident glycosyltransferases that generate branching of diantennary oligosaccharides.
Endogenous Substrate(s) UDP-N-acetylglucosamine
TCDB ID
2.A.7.12.7
Gene ID
23443
Reactome Pathway
Transport of nucleotide sugars (R-HSA-727802 )
Defective SLC35A3 causes arthrogryposis, mental retardation, and seizures (AMRS) (R-HSA-5619083 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.35E-02 1.05E-01 1.74E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.00E-01 7.50E-02 1.68E-01
Alopecia ED70 Skin from scalp 7.63E-01 -4.31E-02 -1.54E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.45E-01 -5.03E-02 -1.77E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.66E-01 -2.97E-01 -9.78E-01
Aortic stenosis BB70 Calcified aortic valve 8.44E-01 -9.84E-02 -2.07E-01
Apnea 7A40 Hyperplastic tonsil 6.85E-01 2.43E-01 4.40E-01
Arthropathy FA00-FA5Z Peripheral blood 1.79E-01 -3.15E-01 -6.96E-01
Asthma CA23 Nasal and bronchial airway 4.86E-02 4.80E-02 7.14E-02
Atopic dermatitis EA80 Skin 1.03E-02 1.97E-01 6.23E-01
Autism 6A02 Whole blood 9.79E-02 4.01E-01 8.37E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.33E-01 -5.57E-02 -9.40E-02
Autosomal dominant monocytopenia 4B04 Whole blood 9.80E-02 2.90E-01 5.14E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.31E-08 -2.78E-01 -7.64E-01
Batten disease 5C56.1 Whole blood 2.38E-01 -9.30E-02 -5.28E-01
Behcet's disease 4A62 Peripheral blood 9.38E-01 -3.83E-03 -1.54E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.16E-01 -1.48E-02 -7.68E-02
Bladder cancer 2C94 Bladder tissue 2.56E-07 -8.77E-01 -3.67E+00
Breast cancer 2C60-2C6Z Breast tissue 3.88E-68 7.78E-01 1.57E+00
Cardioembolic stroke 8B11.20 Whole blood 3.49E-03 -2.54E-01 -1.03E+00
Cervical cancer 2C77 Cervical tissue 9.43E-01 -1.92E-01 -3.16E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.74E-01 -3.37E-01 -3.10E-01
Chronic hepatitis C 1E51.1 Whole blood 7.93E-01 -3.19E-02 -1.54E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.73E-01 -3.25E-02 -9.90E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.78E-01 4.58E-02 1.33E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.72E-01 -3.59E-01 -4.11E-01
Colon cancer 2B90 Colon tissue 1.73E-76 -8.69E-01 -2.43E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.45E-01 7.72E-01 8.48E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.96E-01 1.31E-01 1.24E-01
Endometriosis GA10 Endometrium tissue 1.60E-02 -1.79E-01 -3.63E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.13E-01 3.79E-02 1.54E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.10E-03 5.86E-01 1.11E+00
Gastric cancer 2B72 Gastric tissue 5.03E-01 1.41E-01 1.08E-01
Glioblastopma 2A00.00 Nervous tissue 1.02E-150 9.01E-01 2.20E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.35E-01 1.19E-01 3.10E-01
Head and neck cancer 2D42 Head and neck tissue 1.94E-17 -1.01E+00 -1.13E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.65E-02 1.88E-01 6.08E-01
Huntington's disease 8A01.10 Whole blood 9.33E-01 4.38E-02 1.19E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.16E-01 3.87E-01 8.65E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.11E-03 -2.20E-01 -1.59E+00
Influenza 1.00E+30 Whole blood 2.91E-05 -1.01E+00 -6.70E+00
Interstitial cystitis GC00.3 Bladder tissue 3.68E-03 -6.10E-01 -2.34E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.94E-01 -1.68E-01 -2.69E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.23E-01 -6.88E-03 -3.74E-02
Ischemic stroke 8B11 Peripheral blood 2.01E-01 -1.63E-01 -6.90E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.05E-04 -1.65E-01 -3.61E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.86E-01 -1.80E-01 -3.18E-01
Lateral sclerosis 8B60.4 Skin 1.18E-01 -3.31E-01 -1.15E+00
Liver cancer 2C12.0 Liver tissue 7.48E-04 -4.21E-01 -6.79E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.97E-05 -1.31E+00 -2.65E+00
Lung cancer 2C25 Lung tissue 9.05E-01 -1.93E-02 -5.01E-02
Lupus erythematosus 4A40 Whole blood 6.36E-01 2.46E-01 2.67E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.28E-01 -1.14E-01 -1.95E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.10E-01 2.43E-02 1.31E-01
Melanoma 2C30 Skin 2.40E-03 -4.92E-01 -6.90E-01
Multiple myeloma 2A83.1 Bone marrow 1.39E-05 5.88E-01 3.06E+00
Multiple myeloma 2A83.1 Peripheral blood 9.98E-01 7.76E-02 1.82E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.09E-01 -6.26E-02 -1.74E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.88E-04 -2.94E-01 -8.72E-01
Myelofibrosis 2A20.2 Whole blood 4.89E-01 -8.95E-02 -2.43E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.06E-01 -1.70E-01 -2.36E-01
Myopathy 8C70.6 Muscle tissue 8.96E-01 -1.14E-01 -4.49E-01
Neonatal sepsis KA60 Whole blood 3.75E-01 8.63E-02 1.35E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.12E-05 1.26E+00 2.38E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.13E-01 3.50E-01 9.15E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.60E-01 3.24E-02 9.75E-02
Olive pollen allergy CA08.00 Peripheral blood 5.34E-02 -3.15E-01 -8.45E-01
Oral cancer 2B6E Oral tissue 2.26E-02 3.69E-01 5.22E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.00E-02 6.00E-01 9.42E-01
Osteoporosis FB83.1 Bone marrow 7.58E-01 -5.48E-02 -1.25E-01
Ovarian cancer 2C73 Ovarian tissue 6.00E-04 1.25E+00 1.97E+00
Pancreatic cancer 2C10 Pancreas 2.00E-07 8.28E-01 1.99E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.19E-02 -1.48E-01 -4.01E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.41E-02 -3.88E-02 -1.93E-01
Pituitary cancer 2D12 Pituitary tissue 9.22E-02 -4.11E-02 -1.22E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.14E-01 -2.50E-01 -6.54E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.09E-01 2.84E-02 9.31E-02
Polycythemia vera 2A20.4 Whole blood 2.47E-03 -3.36E-01 -6.70E-01
Pompe disease 5C51.3 Biceps muscle 3.12E-04 -4.70E-01 -2.20E+00
Preterm birth KA21.4Z Myometrium 1.36E-01 6.15E-01 8.43E-01
Prostate cancer 2C82 Prostate 2.27E-01 2.84E-01 4.08E-01
Psoriasis EA90 Skin 2.52E-03 -1.09E-01 -3.26E-01
Rectal cancer 2B92 Rectal colon tissue 2.13E-03 -4.90E-01 -1.91E+00
Renal cancer 2C90-2C91 Kidney 7.00E-04 4.73E-01 1.22E+00
Retinoblastoma 2D02.2 Uvea 1.25E-04 6.69E-01 2.64E+00
Rheumatoid arthritis FA20 Synovial tissue 1.51E-04 7.45E-01 2.78E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.67E-01 3.34E-02 2.10E-01
Schizophrenia 6A20 Prefrontal cortex 4.84E-01 6.40E-02 6.78E-02
Schizophrenia 6A20 Superior temporal cortex 8.21E-01 5.30E-02 4.37E-01
Scleroderma 4A42.Z Whole blood 1.13E-05 -4.96E-01 -2.72E+00
Seizure 8A60-8A6Z Whole blood 8.34E-01 1.38E-01 2.83E-01
Sensitive skin EK0Z Skin 7.88E-01 2.23E-02 9.41E-02
Sepsis with septic shock 1G41 Whole blood 3.27E-16 -2.99E-01 -6.67E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.28E-01 -4.70E-01 -7.61E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.19E-02 -7.40E-02 -1.62E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.84E-01 -2.90E-01 -2.49E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.68E-01 -1.42E-01 -2.48E-01
Skin cancer 2C30-2C3Z Skin 3.42E-26 -4.60E-01 -1.11E+00
Thrombocythemia 3B63 Whole blood 3.87E-02 -1.98E-01 -5.04E-01
Thrombocytopenia 3B64 Whole blood 5.71E-01 1.71E-02 1.50E-02
Thyroid cancer 2D10 Thyroid 6.95E-22 -5.18E-01 -1.40E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.11E-01 1.05E-01 2.88E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.74E-01 -2.31E-01 -6.40E-01
Type 2 diabetes 5A11 Liver tissue 8.86E-02 1.03E-01 3.24E-01
Ureter cancer 2C92 Urothelium 5.80E-01 4.55E-02 9.28E-02
Uterine cancer 2C78 Endometrium tissue 1.07E-07 2.74E-01 4.58E-01
Vitiligo ED63.0 Skin 5.78E-01 6.59E-02 3.13E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases