Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTBMSWG)

DTP Name L-type amino acid transporter 3 (SLC43A1)
Gene Name SLC43A1
UniProt ID
O75387 (LAT3_HUMAN)
VARIDT ID
DTD0360
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms LAT3; Large neutral amino acids transporter small subunit 3; PB39; POV1; Prostate cancer overexpressed gene 1 protein; R00504; SLC43A1; Solute carrier family 43 member 1
DTP Family Major Facilitator Superfamily (MFS)
L-Amino Acid Transporter-3 (LAT3) Family
Sequence
MAPTLQQAYRRRWWMACTAVLENLFFSAVLLGWGSLLIILKNEGFYSSTCPAESSTNTTQ
DEQRRWPGCDQQDEMLNLGFTIGSFVLSATTLPLGILMDRFGPRPVRLVGSACFTASCTL
MALASRDVEALSPLIFLALSLNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAI
TFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAPEEVNYTKKIKLSGLA
LDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLC
SPTFLWSLLTMGMTQLRIIFYMAAVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFG
AMQLLCLLTCPLIGYIMDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQKLTNAI
SAFTLTNLLLVGFGITCLINNLHLQFVTFVLHTIVRGFFHSACGSLYAAVFPSNHFGTLT
GLQSLISAVFALLQQPLFMAMVGPLKGEPFWVNLGLLLFSLLGFLLPSYLFYYRARLQQE
YAANGMGPLKVLSGSEVTA
Function
This sodium-independent transporter is for neutral amino acids and has narrower substrate selectivity compared to SLC7A5 and SLC7A8 and mainly transports branched-chain amino acids and phenylalanine. Plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer.
Endogenous Substrate(s) Amino acid alcohols; 3'-Iodotyrosine
TCDB ID
2.A.1.44.1
Gene ID
8501
Reactome Pathway
Amino acid transport across the plasma membrane (R-HSA-352230 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Phenylalanine DMQXI9F Malnutrition 5B50-5B71 Approved [1]
------------------------------------------------------------------------------------
3 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-isoleucine DM4B6H3 Discovery agent N.A. Investigative [1]
L-leucine DMQHN7I Discovery agent N.A. Investigative [1]
L-valine DM68RPD Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.54E-09 -4.76E-01 -7.37E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.18E-01 -1.59E-01 -5.13E-01
Alopecia ED70 Skin from scalp 1.94E-03 1.64E-01 4.69E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.95E-04 8.86E-02 4.80E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.85E-01 -4.56E-02 -1.37E-01
Aortic stenosis BB70 Calcified aortic valve 7.82E-01 6.34E-02 2.25E-01
Apnea 7A40 Hyperplastic tonsil 3.31E-01 8.74E-02 7.31E-01
Arthropathy FA00-FA5Z Peripheral blood 8.34E-02 -1.42E-01 -8.93E-01
Asthma CA23 Nasal and bronchial airway 9.31E-01 -1.21E-01 -2.65E-01
Atopic dermatitis EA80 Skin 3.58E-08 4.86E-01 1.98E+00
Autism 6A02 Whole blood 3.52E-01 -3.72E-02 -2.19E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.52E-01 -1.14E-01 -5.22E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.21E-02 1.50E-01 1.83E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.12E-18 2.98E-01 1.25E+00
Batten disease 5C56.1 Whole blood 9.39E-01 -4.75E-04 -2.80E-03
Behcet's disease 4A62 Peripheral blood 2.49E-01 -1.47E-01 -5.57E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.59E-01 -3.29E-02 -1.93E-01
Bladder cancer 2C94 Bladder tissue 6.43E-03 -5.63E-01 -1.61E+00
Breast cancer 2C60-2C6Z Breast tissue 1.86E-04 -2.34E-01 -4.82E-01
Cardioembolic stroke 8B11.20 Whole blood 8.24E-03 -1.87E-01 -1.03E+00
Cervical cancer 2C77 Cervical tissue 6.92E-01 -4.25E-02 -1.85E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.49E-01 7.82E-02 4.22E-01
Chronic hepatitis C 1E51.1 Whole blood 9.06E-01 -7.85E-03 -3.95E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 6.64E-01 -1.04E-01 -3.79E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.32E-02 5.85E-02 2.68E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.24E-01 -7.07E-02 -2.52E-01
Colon cancer 2B90 Colon tissue 9.18E-61 6.03E-01 1.97E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.56E-01 1.74E-01 3.52E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.82E-01 -2.82E-01 -4.05E-01
Endometriosis GA10 Endometrium tissue 4.65E-02 -2.09E-01 -2.84E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.11E-01 2.88E-02 2.58E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.74E-01 2.63E-02 1.64E-01
Gastric cancer 2B72 Gastric tissue 8.82E-01 4.12E-01 6.08E-01
Glioblastopma 2A00.00 Nervous tissue 7.06E-01 -2.54E-02 -8.78E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.04E-01 9.12E-02 2.10E-01
Head and neck cancer 2D42 Head and neck tissue 1.35E-01 2.82E-02 8.83E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.51E-02 -7.14E-02 -4.68E-01
Huntington's disease 8A01.10 Whole blood 2.35E-01 -3.34E-02 -2.46E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.14E-01 -6.13E-01 -1.05E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.94E-01 -1.09E-01 -1.14E+00
Influenza 1.00E+30 Whole blood 7.92E-04 8.49E-01 4.13E+00
Interstitial cystitis GC00.3 Bladder tissue 3.17E-01 1.72E-01 4.50E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.46E-01 -2.53E-01 -5.03E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.89E-01 -1.40E-02 -4.43E-02
Ischemic stroke 8B11 Peripheral blood 4.06E-01 -1.97E-02 -1.22E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.90E-06 -2.13E-01 -4.30E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.93E-01 6.85E-02 2.36E-01
Lateral sclerosis 8B60.4 Skin 3.45E-01 6.92E-02 9.87E-01
Liver cancer 2C12.0 Liver tissue 5.59E-08 -3.37E-01 -8.82E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.08E-02 -1.63E+00 -3.25E+00
Lung cancer 2C25 Lung tissue 1.94E-08 -2.65E-01 -8.16E-01
Lupus erythematosus 4A40 Whole blood 9.68E-03 -1.21E-01 -3.27E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.50E-01 -8.89E-02 -2.74E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.22E-01 -9.09E-03 -4.98E-02
Melanoma 2C30 Skin 8.04E-01 -1.01E-01 -1.32E-01
Multiple myeloma 2A83.1 Bone marrow 1.03E-01 -5.81E-03 -2.69E-02
Multiple myeloma 2A83.1 Peripheral blood 9.85E-01 3.57E-02 1.77E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.01E-02 1.38E-01 9.94E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.17E-07 3.36E-01 1.13E+00
Myelofibrosis 2A20.2 Whole blood 2.26E-02 5.22E-01 3.41E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.67E-03 -2.27E-01 -5.72E-01
Myopathy 8C70.6 Muscle tissue 1.18E-02 -2.58E-01 -8.59E-01
Neonatal sepsis KA60 Whole blood 5.39E-01 4.27E-02 1.92E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.56E-01 -2.67E-01 -1.00E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.16E-01 -2.29E-01 -6.96E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.77E-01 4.52E-02 1.18E-01
Olive pollen allergy CA08.00 Peripheral blood 9.22E-01 -1.88E-03 -9.87E-03
Oral cancer 2B6E Oral tissue 1.84E-03 -3.35E-01 -6.21E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.82E-01 1.51E-01 3.90E-01
Osteoporosis FB83.1 Bone marrow 6.75E-02 3.48E-01 1.17E+00
Ovarian cancer 2C73 Ovarian tissue 5.03E-04 -1.07E+00 -2.27E+00
Pancreatic cancer 2C10 Pancreas 4.10E-03 -2.01E+00 -1.33E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.31E-01 -1.82E-01 -8.57E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.33E-02 5.00E-02 4.84E-01
Pituitary cancer 2D12 Pituitary tissue 5.33E-01 -9.42E-03 -4.25E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.79E-02 -6.28E-02 -2.46E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.27E-02 -9.92E-02 -6.61E-01
Polycythemia vera 2A20.4 Whole blood 5.17E-02 -1.07E-01 -7.33E-01
Pompe disease 5C51.3 Biceps muscle 3.66E-02 -7.75E-01 -1.21E+00
Preterm birth KA21.4Z Myometrium 9.28E-03 -3.20E-01 -1.48E+00
Prostate cancer 2C82 Prostate 3.57E-02 2.20E-01 3.73E-01
Psoriasis EA90 Skin 2.13E-21 -7.10E-01 -1.69E+00
Rectal cancer 2B92 Rectal colon tissue 3.92E-03 4.13E-01 1.86E+00
Renal cancer 2C90-2C91 Kidney 6.88E-03 -1.02E+00 -1.31E+00
Retinoblastoma 2D02.2 Uvea 4.03E-04 6.15E-01 3.12E+00
Rheumatoid arthritis FA20 Synovial tissue 7.85E-08 9.39E-01 4.88E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.91E-01 -1.14E-03 -1.52E-02
Schizophrenia 6A20 Prefrontal cortex 1.17E-01 1.51E-01 3.37E-01
Schizophrenia 6A20 Superior temporal cortex 1.79E-01 2.07E-02 1.88E-01
Scleroderma 4A42.Z Whole blood 6.13E-04 -1.88E-01 -1.64E+00
Seizure 8A60-8A6Z Whole blood 5.33E-01 4.51E-02 1.39E-01
Sensitive skin EK0Z Skin 4.77E-01 9.68E-02 2.31E-01
Sepsis with septic shock 1G41 Whole blood 6.81E-02 -3.39E-02 -1.46E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.59E-01 -1.16E-01 -4.94E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.81E-01 1.59E-01 9.09E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.32E-01 5.34E-02 2.88E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.63E-01 -4.18E-01 -1.04E+00
Skin cancer 2C30-2C3Z Skin 2.74E-32 -6.63E-01 -1.39E+00
Thrombocythemia 3B63 Whole blood 5.28E-01 -3.64E-02 -2.64E-01
Thrombocytopenia 3B64 Whole blood 8.60E-01 4.86E-01 4.50E-01
Thyroid cancer 2D10 Thyroid 1.87E-08 -3.73E-01 -1.29E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.61E-01 3.56E-02 7.44E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.53E-01 1.15E-01 1.07E+00
Type 2 diabetes 5A11 Liver tissue 5.12E-02 -3.76E-01 -1.53E+00
Ureter cancer 2C92 Urothelium 6.53E-01 3.84E-02 1.57E-01
Uterine cancer 2C78 Endometrium tissue 6.86E-19 -1.43E+00 -1.28E+00
Vitiligo ED63.0 Skin 6.56E-01 -1.42E-01 -3.03E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Identification of a novel system L amino acid transporter structurally distinct from heterodimeric amino acid transporters. J Biol Chem. 2003 Oct 31;278(44):43838-45.