Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTBTZ5A)

DTP Name Mitochondrial sodium/calcium exchanger protein (SLC8B1)
Gene Name SLC8B1
UniProt ID
Q6J4K2 (NCLX_HUMAN)
VARIDT ID
DTD0480
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
NCKX6; NCLX; Na(+)/K(+)/Ca(2+)-exchange protein 6; SLC24A6; SLC8B1; Sodium/calcium exchanger protein, mitochondrial; Sodium/potassium/calcium exchanger 6; Solute carrier family 24 member 6; Solute carrier family 8 member B1
DTP Family Ca(2+):Cation Antiporter (CACA) Family ;
Tissue Specificity Present in pancreatic beta-cells (at proteinlevel).
Sequence
MAGRRLNLRWALSVLCVLLMAETVSGTRGSSTGAHISPQFPASGVNQTPVVDCRKVCGLN
VSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK
FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAFSDPHTAGLALGALFGAGVL
VTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFY
VVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQET
TAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNC
LHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWL
FAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLAR
QGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVF
SLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHLKSM
Function This transporter is mitochondrial sodium/calcium antiporter that mediates sodium-dependent calcium efflux from mitochondrion.
Endogenous Substrate(s) Ca2+; K+; Na+
TCDB ID
2.A.19.4.4
Gene ID
80024
Reactome Pathway
Mitochondrial calcium ion transport (R-HSA-8949215 )
Sodium/Calcium exchangers (R-HSA-425561 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.68E-12 -2.65E-01 -8.15E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.61E-01 3.69E-01 9.15E-01
Alopecia ED70 Skin from scalp 6.59E-02 1.09E-01 5.42E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.93E-02 2.44E-02 1.67E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.78E-02 2.35E-01 7.89E-01
Aortic stenosis BB70 Calcified aortic valve 4.49E-01 2.41E-01 5.77E-01
Apnea 7A40 Hyperplastic tonsil 5.30E-01 1.18E-01 1.31E+00
Arthropathy FA00-FA5Z Peripheral blood 7.94E-01 -2.83E-02 -1.74E-01
Asthma CA23 Nasal and bronchial airway 4.13E-01 3.01E-02 9.98E-02
Atopic dermatitis EA80 Skin 6.17E-02 4.00E-02 1.20E-01
Autism 6A02 Whole blood 3.10E-01 -5.61E-02 -1.98E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.01E-01 2.42E-01 1.01E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.45E-03 -2.59E-01 -1.42E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.94E-06 1.55E-01 8.16E-01
Batten disease 5C56.1 Whole blood 4.08E-01 -9.24E-02 -4.99E-01
Behcet's disease 4A62 Peripheral blood 7.98E-01 8.33E-02 2.05E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.52E-01 1.82E-02 1.34E-01
Bladder cancer 2C94 Bladder tissue 4.85E-01 1.18E-01 4.52E-01
Breast cancer 2C60-2C6Z Breast tissue 5.31E-02 3.82E-02 1.15E-01
Cardioembolic stroke 8B11.20 Whole blood 1.91E-04 -1.58E-01 -1.01E+00
Cervical cancer 2C77 Cervical tissue 5.28E-03 2.55E-01 1.10E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.70E-01 1.62E-01 3.22E-01
Chronic hepatitis C 1E51.1 Whole blood 4.38E-01 6.23E-02 2.54E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.81E-01 -1.77E-02 -7.25E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.52E-01 -3.40E-02 -1.05E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.30E-02 2.09E-01 1.90E+00
Colon cancer 2B90 Colon tissue 7.68E-48 -4.85E-01 -1.75E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.11E-01 1.27E-01 9.00E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.42E-01 -7.66E-02 -4.72E-01
Endometriosis GA10 Endometrium tissue 8.87E-04 3.79E-01 1.43E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.23E-01 -1.47E-01 -5.88E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.21E-01 2.03E-02 1.46E-01
Gastric cancer 2B72 Gastric tissue 5.63E-02 1.96E-01 1.41E+00
Glioblastopma 2A00.00 Nervous tissue 6.53E-01 -7.74E-02 -2.61E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.96E-05 -4.32E-01 -1.65E+00
Head and neck cancer 2D42 Head and neck tissue 8.48E-07 1.57E-01 6.38E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.27E-01 4.44E-02 3.31E-01
Huntington's disease 8A01.10 Whole blood 3.77E-01 -1.61E-02 -1.32E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.29E-01 1.78E-01 1.07E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.33E-02 -2.18E-01 -1.09E+00
Influenza 1.00E+30 Whole blood 4.72E-04 -2.39E-01 -5.76E+00
Interstitial cystitis GC00.3 Bladder tissue 9.35E-01 2.20E-02 9.77E-02
Intracranial aneurysm 8B01.0 Intracranial artery 2.04E-01 4.53E-02 3.92E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.79E-01 -8.41E-02 -3.55E-01
Ischemic stroke 8B11 Peripheral blood 1.22E-01 -1.31E-01 -6.46E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.33E-05 -1.64E-01 -5.65E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.49E-01 3.36E-02 1.27E-01
Lateral sclerosis 8B60.4 Skin 4.54E-01 -1.36E-01 -6.60E-01
Liver cancer 2C12.0 Liver tissue 3.63E-06 -2.17E-01 -6.61E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.91E-01 4.06E-02 1.81E-01
Lung cancer 2C25 Lung tissue 1.32E-22 -2.84E-01 -9.57E-01
Lupus erythematosus 4A40 Whole blood 1.50E-01 4.12E-02 1.57E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.28E-02 3.32E-02 1.77E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.70E-01 -7.77E-02 -5.79E-01
Melanoma 2C30 Skin 9.79E-01 -1.01E-01 -2.97E-01
Multiple myeloma 2A83.1 Bone marrow 1.19E-07 -6.35E-01 -6.27E+00
Multiple myeloma 2A83.1 Peripheral blood 2.90E-01 1.16E-01 9.14E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.24E-02 1.34E-01 7.00E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.14E-03 -1.76E-01 -6.67E-01
Myelofibrosis 2A20.2 Whole blood 6.95E-04 -2.07E-01 -1.60E+00
Myocardial infarction BA41-BA50 Peripheral blood 7.51E-03 1.87E-01 6.83E-01
Myopathy 8C70.6 Muscle tissue 3.77E-01 1.34E-01 8.13E-01
Neonatal sepsis KA60 Whole blood 9.72E-14 3.10E-01 1.17E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.13E-05 -7.97E-01 -3.04E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.98E-01 1.37E-01 7.62E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.00E-01 -2.80E-02 -4.05E-01
Olive pollen allergy CA08.00 Peripheral blood 2.32E-01 2.62E-01 5.17E-01
Oral cancer 2B6E Oral tissue 7.95E-01 -6.13E-03 -2.24E-02
Osteoarthritis FA00-FA0Z Synovial tissue 6.46E-01 7.18E-02 1.68E-01
Osteoporosis FB83.1 Bone marrow 6.51E-03 3.23E-01 3.02E+00
Ovarian cancer 2C73 Ovarian tissue 2.19E-03 -9.21E-01 -1.87E+00
Pancreatic cancer 2C10 Pancreas 4.82E-02 4.43E-01 7.98E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.18E-01 -2.95E-02 -1.29E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.19E-01 6.13E-03 4.18E-02
Pituitary cancer 2D12 Pituitary tissue 2.67E-03 -4.56E-01 -1.32E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.90E-04 -8.39E-01 -2.44E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.51E-01 -7.98E-03 -4.72E-02
Polycythemia vera 2A20.4 Whole blood 1.67E-02 -1.03E-01 -7.20E-01
Pompe disease 5C51.3 Biceps muscle 9.48E-01 3.37E-03 2.60E-02
Preterm birth KA21.4Z Myometrium 3.14E-02 -2.58E-01 -3.14E+00
Prostate cancer 2C82 Prostate 4.08E-03 -4.04E-01 -1.13E+00
Psoriasis EA90 Skin 3.48E-01 1.73E-02 5.45E-02
Rectal cancer 2B92 Rectal colon tissue 1.29E-02 -1.88E-01 -1.06E+00
Renal cancer 2C90-2C91 Kidney 1.40E-01 -2.96E-01 -7.33E-01
Retinoblastoma 2D02.2 Uvea 2.05E-02 1.96E-01 2.15E+00
Rheumatoid arthritis FA20 Synovial tissue 1.67E-04 1.07E+00 3.08E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.72E-01 2.41E-02 1.32E-01
Schizophrenia 6A20 Prefrontal cortex 3.80E-02 2.17E-01 3.78E-01
Schizophrenia 6A20 Superior temporal cortex 5.28E-02 -2.43E-02 -2.91E-01
Scleroderma 4A42.Z Whole blood 6.96E-03 -2.17E-01 -9.60E-01
Seizure 8A60-8A6Z Whole blood 4.66E-01 -2.40E-02 -1.18E-01
Sensitive skin EK0Z Skin 8.03E-01 -1.03E-02 -6.08E-02
Sepsis with septic shock 1G41 Whole blood 4.98E-05 5.80E-02 2.13E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.66E-01 -5.67E-02 -4.60E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.38E-01 1.72E-01 1.14E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.67E-01 -1.26E-02 -6.09E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.20E-01 -2.77E-01 -1.19E+00
Skin cancer 2C30-2C3Z Skin 3.12E-08 -2.28E-01 -6.67E-01
Thrombocythemia 3B63 Whole blood 3.18E-03 -8.51E-02 -6.63E-01
Thrombocytopenia 3B64 Whole blood 5.54E-01 4.59E-01 4.07E-01
Thyroid cancer 2D10 Thyroid 5.22E-01 4.67E-02 2.09E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.47E-01 3.76E-02 2.20E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.23E-03 4.69E-01 6.56E+00
Type 2 diabetes 5A11 Liver tissue 2.01E-01 -9.17E-02 -3.72E-01
Ureter cancer 2C92 Urothelium 8.51E-01 1.90E-02 8.44E-02
Uterine cancer 2C78 Endometrium tissue 1.66E-03 -2.00E-01 -5.89E-01
Vitiligo ED63.0 Skin 6.16E-01 2.00E-02 1.50E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Sodium/potassium/calcium exchanger 6 (SLC8B1) DTT Info
DTP DTT Type Literature-reported