Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTCX7UI)

• DTP Name: ATP synthase subunit epsilon (ATP5E)
• Gene Name: ATP5E
• UniProt ID: P56381 (ATP5E_HUMAN)
• VARIDT ID: DTD0517
• Synonyms: ATP synthase F1 subunit epsilon; ATP5E; ATP5F1E; ATPE; ATPase subunit epsilon; MC5DN3
• DTP Family: P-Type ATPase (P-ATPase) Superfamily
• Tissue Specificity: Ubiquitous.
• Sequence: MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
• Function: This transporter is a mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
• Endogenous Substrate(s): H+
• TCDB ID: 3.A.3
• Gene ID: 514
• KEGG Pathway:
  Oxidative phosphorylation (hsa00190)
  Metabolic pathways (hsa01100)
  Thermogenesis (hsa04714)
  Alzheimer disease (hsa05010)
  Parkinson disease (hsa05012)
  Amyotrophic lateral sclerosis (hsa05014)
  Huntington disease (hsa05016)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Diabetic cardiomyopathy (hsa05415)
• Reactome Pathway:
  Cristae formation (R-HSA-8949613)
  Formation of ATP by chemiosmotic coupling (R-HSA-163210)
• BioCyc Pathway: MetaCyc:HS04727-MON