DTP Name |
ATP synthase subunit epsilon (ATP5E)
|
Gene Name |
ATP5E
|
UniProt ID |
|
VARIDT ID |
|
3D Structure |
|
Synonyms |
ATP synthase F1 subunit epsilon; ATP5E; ATP5F1E; ATPE; ATPase subunit epsilon; MC5DN3 |
DTP Family |
P-Type ATPase (P-ATPase) Superfamily
;
|
Tissue Specificity |
Ubiquitous.
|
Sequence |
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
|
Function |
This transporter is a mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
|
Endogenous Substrate(s) |
H+
|
TCDB ID |
|
Gene ID |
|
KEGG Pathway |
- Oxidative phosphorylation (hsa00190 )
- Metabolic pathways (hsa01100 )
- Thermogenesis (hsa04714 )
- Alzheimer disease (hsa05010 )
- Parkinson disease (hsa05012 )
- Amyotrophic lateral sclerosis (hsa05014 )
- Huntington disease (hsa05016 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Chemical carcinogenesis - reactive oxygen species (hsa05208 )
- Diabetic cardiomyopathy (hsa05415 )
|
Reactome Pathway |
- Cristae formation (R-HSA-8949613 )
- Formation of ATP by chemiosmotic coupling (R-HSA-163210 )
|
BioCyc Pathway |
- MetaCyc:HS04727-MON
|
|
|
|
|
|
|