Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTD5Y4G)

DTP Name Sodium-dependent multivitamin transporter (SLC5A6)
Gene Name SLC5A6
UniProt ID
Q9Y289 (SC5A6_HUMAN)
VARIDT ID
DTD0426
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Na(+)-dependent multivitamin transporter; SLC5A6; SMVT; Solute carrier family 5 member 6
DTP Family Solute:Sodium Symporter (SSS) Family ;
Sequence
MSVGVSTSAPLSPTSGTSVGMSTFSIMDYVVFVLLLVLSLAIGLYHACRGWGRHTVGELL
MADRKMGCLPVALSLLATFQSAVAILGVPSEIYRFGTQYWFLGCCYFLGLLIPAHIFIPV
FYRLHLTSAYEYLELRFNKTVRVCGTVTFIFQMVIYMGVVLYAPSLALNAVTGFDLWLSV
LALGIVCTVYTALGGLKAVIWTDVFQTLVMFLGQLAVIIVGSAKVGGLGRVWAVASQHGR
ISGFELDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSRTEKAAVLSCYAVFPF
QQVSLCVGCLIGLVMFAYYQEYPMSIQQAQAAPDQFVLYFVMDLLKGLPGLPGLFIACLF
SGSLSTISSAFNSLATVTMEDLIRPWFPEFSEARAIMLSRGLAFGYGLLCLGMAYISSQM
GPVLQAAISIFGMVGGPLLGLFCLGMFFPCANPPGAVVGLLAGLVMAFWIGIGSIVTSMG
SSMPPSPSNGSSFSLPTNLTVATVTTLMPLTTFSKPTGLQRFYSLSYLWYSAHNSTTVIV
VGLIVSLLTGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKP
RNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL
Function This dodium-dependent transporter is mediates the transport of pantothenate, biotin and lipoate.
Endogenous Substrate(s) Na+
TCDB ID
2.A.21.5.7
Gene ID
8884
KEGG Pathway
Vitamin digestion and absorption (hsa04977 )
Reactome Pathway
Vitamin B5 (pantothenate) metabolism (R-HSA-199220 )
Transport of vitamins, nucleosides, and related molecules (R-HSA-425397 )
Biotin transport and metabolism (R-HSA-196780 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Clinical Trial Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Gabapentin enacarbil DMJY2TM Postherpetic neuralgia 1E91.5 Phase 2 [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.67E-14 3.51E-01 9.00E-01
Adrenocortical carcinoma 2D11.Z Kidney 4.02E-01 5.97E-02 2.11E-01
Alopecia ED70 Skin from scalp 2.03E-01 4.14E-02 1.93E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.89E-01 2.62E-02 7.70E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 2.14E-02 1.28E-01 5.83E-01
Aortic stenosis BB70 Calcified aortic valve 1.32E-01 3.73E-01 1.18E+00
Apnea 7A40 Hyperplastic tonsil 8.70E-01 -1.17E-01 -3.17E-01
Arthropathy FA00-FA5Z Peripheral blood 2.93E-01 -2.20E-01 -1.06E+00
Asthma CA23 Nasal and bronchial airway 1.52E-05 2.51E-01 4.12E-01
Atopic dermatitis EA80 Skin 8.38E-11 5.57E-01 2.40E+00
Autism 6A02 Whole blood 9.99E-01 1.80E-02 7.02E-02
Autoimmune uveitis 9A96 Peripheral monocyte 8.84E-01 -8.75E-02 -3.93E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.43E-01 4.92E-02 1.15E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.59E-03 1.15E-01 5.29E-01
Batten disease 5C56.1 Whole blood 4.56E-01 6.92E-02 4.53E-01
Behcet's disease 4A62 Peripheral blood 9.28E-01 -3.60E-02 -2.52E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.45E-01 5.57E-03 2.24E-02
Bladder cancer 2C94 Bladder tissue 8.51E-06 8.85E-01 3.05E+00
Breast cancer 2C60-2C6Z Breast tissue 1.76E-24 3.45E-01 7.73E-01
Cardioembolic stroke 8B11.20 Whole blood 5.22E-02 -9.52E-02 -5.32E-01
Cervical cancer 2C77 Cervical tissue 8.23E-01 -7.73E-03 -2.57E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.02E-01 2.12E-02 4.67E-02
Chronic hepatitis C 1E51.1 Whole blood 1.73E-01 2.17E-01 7.71E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.27E-01 5.58E-02 2.02E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.32E-01 6.54E-03 2.47E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.15E-02 1.95E-01 1.27E+00
Colon cancer 2B90 Colon tissue 6.68E-99 9.83E-01 2.99E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.90E-01 5.69E-03 2.04E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.36E-01 -6.99E-04 -2.42E-03
Endometriosis GA10 Endometrium tissue 5.29E-01 5.18E-02 2.24E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.33E-01 1.22E-01 7.61E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.70E-03 2.35E-01 9.76E-01
Gastric cancer 2B72 Gastric tissue 6.75E-02 1.02E+00 2.08E+00
Glioblastopma 2A00.00 Nervous tissue 1.71E-06 -7.77E-02 -2.07E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.84E-03 1.13E+00 1.62E+00
Head and neck cancer 2D42 Head and neck tissue 1.04E-05 1.33E-01 4.22E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.54E-01 4.95E-03 3.20E-02
Huntington's disease 8A01.10 Whole blood 3.33E-01 -2.91E-03 -1.40E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.41E-01 6.59E-02 2.59E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.92E-01 9.22E-02 6.94E-01
Influenza 1.00E+30 Whole blood 3.06E-02 -8.12E-01 -3.27E+00
Interstitial cystitis GC00.3 Bladder tissue 1.72E-01 1.60E-01 6.18E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.12E-02 3.21E-01 1.07E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.54E-03 1.46E-01 4.20E-01
Ischemic stroke 8B11 Peripheral blood 8.31E-01 1.88E-02 3.94E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 3.65E-06 -1.73E-01 -6.14E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.88E-01 2.88E-01 5.74E-01
Lateral sclerosis 8B60.4 Skin 3.59E-05 5.35E-01 6.86E+00
Liver cancer 2C12.0 Liver tissue 7.96E-04 4.00E-01 5.01E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.68E-03 -1.16E+00 -1.43E+00
Lung cancer 2C25 Lung tissue 8.49E-103 6.56E-01 2.46E+00
Lupus erythematosus 4A40 Whole blood 9.12E-01 -4.35E-02 -8.00E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.16E-01 -4.63E-02 -1.35E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.57E-01 -2.31E-02 -9.09E-02
Melanoma 2C30 Skin 9.08E-01 -3.31E-01 -3.52E-01
Multiple myeloma 2A83.1 Bone marrow 2.76E-03 4.75E-01 1.61E+00
Multiple myeloma 2A83.1 Peripheral blood 7.07E-01 2.97E-02 1.13E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.84E-01 -9.02E-02 -4.71E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.53E-01 5.35E-02 1.25E-01
Myelofibrosis 2A20.2 Whole blood 1.86E-01 -1.94E-01 -1.36E+00
Myocardial infarction BA41-BA50 Peripheral blood 8.82E-02 6.61E-02 7.40E-02
Myopathy 8C70.6 Muscle tissue 8.51E-01 -1.40E-02 -5.19E-02
Neonatal sepsis KA60 Whole blood 9.27E-01 -5.67E-02 -1.77E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.16E-02 3.43E-02 1.35E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.26E-01 -1.63E-01 -2.53E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.90E-02 4.16E-01 8.59E-01
Olive pollen allergy CA08.00 Peripheral blood 2.40E-01 -2.99E-01 -9.95E-01
Oral cancer 2B6E Oral tissue 4.67E-03 3.75E-01 8.68E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.22E-01 3.61E-02 1.18E-01
Osteoporosis FB83.1 Bone marrow 5.65E-01 -1.55E-02 -4.97E-02
Ovarian cancer 2C73 Ovarian tissue 5.27E-05 9.27E-01 2.58E+00
Pancreatic cancer 2C10 Pancreas 6.67E-01 4.59E-02 7.69E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 2.07E-03 4.55E-01 1.75E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.22E-02 -1.05E-01 -4.31E-01
Pituitary cancer 2D12 Pituitary tissue 2.02E-01 -7.55E-04 -2.50E-03
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.86E-01 -1.43E-01 -5.04E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.68E-01 -1.16E-01 -6.91E-01
Polycythemia vera 2A20.4 Whole blood 4.05E-01 -1.66E-02 -1.02E-01
Pompe disease 5C51.3 Biceps muscle 6.34E-05 9.94E-01 2.19E+00
Preterm birth KA21.4Z Myometrium 2.89E-01 2.23E-01 5.08E-01
Prostate cancer 2C82 Prostate 1.71E-03 2.81E-01 6.43E-01
Psoriasis EA90 Skin 7.84E-13 6.00E-01 1.38E+00
Rectal cancer 2B92 Rectal colon tissue 6.16E-11 1.24E+00 8.07E+00
Renal cancer 2C90-2C91 Kidney 6.88E-01 1.73E-01 3.97E-01
Retinoblastoma 2D02.2 Uvea 1.35E-06 1.08E+00 3.27E+00
Rheumatoid arthritis FA20 Synovial tissue 2.09E-02 3.09E-01 1.15E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.92E-01 9.92E-03 6.38E-02
Schizophrenia 6A20 Prefrontal cortex 9.37E-01 -6.40E-02 -2.73E-01
Schizophrenia 6A20 Superior temporal cortex 6.36E-01 4.97E-02 2.23E-01
Scleroderma 4A42.Z Whole blood 6.07E-01 -1.34E-02 -8.82E-02
Seizure 8A60-8A6Z Whole blood 5.46E-01 1.39E-02 3.19E-02
Sensitive skin EK0Z Skin 1.57E-01 4.66E-01 1.76E+00
Sepsis with septic shock 1G41 Whole blood 1.23E-04 -1.10E-01 -4.56E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.62E-02 -3.06E-01 -1.64E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.75E-01 -2.96E-01 -5.09E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.37E-01 -3.77E-01 -7.32E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.59E-01 5.77E-02 7.45E-01
Skin cancer 2C30-2C3Z Skin 4.90E-60 1.05E+00 1.68E+00
Thrombocythemia 3B63 Whole blood 7.66E-02 8.68E-02 5.64E-01
Thrombocytopenia 3B64 Whole blood 5.60E-01 3.79E-01 5.31E-01
Thyroid cancer 2D10 Thyroid 7.94E-01 -1.86E-02 -9.36E-02
Tibial muscular dystrophy 8C75 Muscle tissue 6.77E-01 -4.97E-03 -1.85E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.50E-01 -1.12E-01 -4.25E-01
Type 2 diabetes 5A11 Liver tissue 3.13E-01 -3.66E-01 -1.03E+00
Ureter cancer 2C92 Urothelium 8.95E-01 5.13E-02 2.94E-01
Uterine cancer 2C78 Endometrium tissue 9.45E-02 1.32E-01 2.73E-01
Vitiligo ED63.0 Skin 9.92E-01 1.37E-02 5.43E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Sodium-dependent multivitamin transporter (SLC5A6) DTT Info
DTP DTT Type Successful
1 Clinical Trial Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Gabapentin enacarbil DMJY2TM Postherpetic neuralgia 1E91.5 Phase 2 [1]
------------------------------------------------------------------------------------

References

1 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
2 Clinical pharmacokinetic drug interaction studies of gabapentin enacarbil, a novel transported prodrug of gabapentin, with naproxen and cimetidine. Br J Clin Pharmacol. 2010 May;69(5):498-507.